BLASTX nr result
ID: Papaver25_contig00004163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00004163 (459 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutr... 84 2e-14 ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [C... 82 6e-14 ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatu... 82 6e-14 ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana... 82 8e-14 gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 82 8e-14 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 82 8e-14 ref|XP_002884539.1| low temperature and salt responsive protein ... 82 8e-14 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 82 1e-13 gb|AFI47457.1| low temperature and salt responsive protein [Medi... 82 1e-13 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 81 2e-13 ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [G... 81 2e-13 gb|ACU14699.1| unknown [Glycine max] 81 2e-13 gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulu... 80 2e-13 ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like is... 80 2e-13 ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Caps... 80 2e-13 gb|AEJ20974.1| cold-inducible protein [Caragana jubata] 80 2e-13 ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus... 80 2e-13 gb|AAQ84111.1| Clt1 [Citrus trifoliata] 80 2e-13 ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like is... 80 4e-13 ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, part... 80 4e-13 >ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] gi|557109161|gb|ESQ49468.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] Length = 111 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGCK+EFWICL+LTLLGYLPGIIYA+ Sbjct: 66 ILAIILPPLGVFLKFGCKIEFWICLILTLLGYLPGIIYAL 105 >ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 54 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGC VEFWICL+LT+LGYLPGIIYAI Sbjct: 10 ILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAI 49 >ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatula] gi|87241339|gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula] gi|355501147|gb|AES82350.1| Hydrophobic protein LTI6A [Medicago truncatula] gi|388497498|gb|AFK36815.1| unknown [Medicago truncatula] Length = 54 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGC VEFWICL+LT+LGYLPGIIYAI Sbjct: 10 ILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAI 49 >ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] gi|15214252|sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B gi|6671968|gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] gi|13957673|gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana] gi|4039152|gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|4325219|gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana] gi|21536934|gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] gi|51970648|dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|109134195|gb|ABG25095.1| At3g05890 [Arabidopsis thaliana] gi|110737346|dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|332640791|gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] Length = 54 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+ Sbjct: 10 ILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYAL 49 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+ Sbjct: 10 ILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYAL 49 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+ Sbjct: 682 ILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYAL 721 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+ Sbjct: 10 ILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYAL 49 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFL+FGCKVEFWICL+LT+LGY+PGIIYAI Sbjct: 10 ILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAI 49 >gb|AFI47457.1| low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGC VEFWICL+LT+LGYLPGI+YAI Sbjct: 10 ILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGILYAI 49 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGCKVEFWICL+LT+ GY+PGIIYA+ Sbjct: 13 ILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAV 52 >ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max] Length = 57 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 +LAIILPPLGVFLK+GCKVEFWICLVLTL GY+PGIIYA+ Sbjct: 13 LLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAV 52 >gb|ACU14699.1| unknown [Glycine max] Length = 57 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 +LAIILPPLGVFLK+GCKVEFWICLVLTL GY+PGIIYA+ Sbjct: 13 LLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAV 52 >gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulus guttatus] Length = 54 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 I+AI+LPPLGVFLKFGC+VEFWICLVLTL GYLPGIIYAI Sbjct: 10 IVAILLPPLGVFLKFGCEVEFWICLVLTLFGYLPGIIYAI 49 >ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria italica] Length = 57 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ++AIILPPLGVFLKFGCKVEFW+CL+LT LGYLPGIIYAI Sbjct: 12 LIAIILPPLGVFLKFGCKVEFWLCLLLTFLGYLPGIIYAI 51 >ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] gi|482567642|gb|EOA31831.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] Length = 54 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 +LAI+LPPLGVFLKFGCKVEFWICL+LTL GYLPGI+YA+ Sbjct: 10 LLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYAL 49 >gb|AEJ20974.1| cold-inducible protein [Caragana jubata] Length = 54 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILAIILPPLGVFLKFGC VEFWICLVLT+LGY+PGI+YA+ Sbjct: 10 ILAIILPPLGVFLKFGCNVEFWICLVLTILGYIPGILYAL 49 >ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus communis] gi|223548547|gb|EEF50038.1| Hydrophobic protein LTI6A, putative [Ricinus communis] Length = 56 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 +LAIILPPLGVFLK+GCKVEFWICL+LTL GY+PGIIYA+ Sbjct: 12 LLAIILPPLGVFLKYGCKVEFWICLILTLFGYIPGIIYAV 51 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 ILA+ILPPLGVFLKFGCK EFWICL+LT+LGY+PGIIYA+ Sbjct: 10 ILAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAV 49 >ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Citrus sinensis] gi|568853390|ref|XP_006480342.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Citrus sinensis] Length = 58 Score = 79.7 bits (195), Expect = 4e-13 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 +LA+ILPPLGVFLKFGCK EFWICL+LT+LGY+PGIIYA+ Sbjct: 13 LLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAV 52 >ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] gi|557530402|gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 79.7 bits (195), Expect = 4e-13 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = +3 Query: 3 ILAIILPPLGVFLKFGCKVEFWICLVLTLLGYLPGIIYAI 122 +LA+ILPPLGVFLKFGCK EFWICL+LT+LGY+PGIIYA+ Sbjct: 59 LLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAV 98