BLASTX nr result
ID: Papaver25_contig00003817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00003817 (751 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515206.1| chlorophyll A/B binding protein, putative [R... 69 2e-09 ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245... 66 1e-08 ref|XP_004234063.1| PREDICTED: chlorophyll a-b binding protein 3... 66 1e-08 ref|XP_004234062.1| PREDICTED: chlorophyll a-b binding protein 3... 66 1e-08 ref|XP_004234058.1| PREDICTED: chlorophyll a-b binding protein 3... 66 1e-08 dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein... 66 1e-08 sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding pro... 66 1e-08 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein... 66 1e-08 sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding pro... 66 1e-08 sp|P12470.1|CB25_NICPL RecName: Full=Chlorophyll a-b binding pro... 66 1e-08 sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding pro... 66 1e-08 gb|ABQ32304.1| chloroplast light-harvesting chlorophyll a/b-bind... 65 2e-08 ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 5... 65 3e-08 ref|XP_007221496.1| hypothetical protein PRUPE_ppa010066mg [Prun... 65 3e-08 ref|XP_006356078.1| PREDICTED: chlorophyll a-b binding protein 3... 65 3e-08 ref|XP_006356077.1| PREDICTED: chlorophyll a-b binding protein 3... 65 3e-08 ref|XP_006356076.1| PREDICTED: chlorophyll a-b binding protein 3... 65 3e-08 ref|XP_006356075.1| PREDICTED: chlorophyll a-b binding protein 3... 65 3e-08 gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum l... 65 3e-08 sp|P07369.1|CB2G_SOLLC RecName: Full=Chlorophyll a-b binding pro... 65 3e-08 >ref|XP_002515206.1| chlorophyll A/B binding protein, putative [Ricinus communis] gi|223545686|gb|EEF47190.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 267 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = -2 Query: 750 VSLNSQSEFPTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 V L++Q+E P VRSS N +++MR GSPWYGPDRVKYLGPFSGE PSYL Sbjct: 15 VPLSAQTELPATVRSS-NGRVTMRKTAGKPAASS-GSPWYGPDRVKYLGPFSGEPPSYL 71 >ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245729 [Solanum lycopersicum] Length = 554 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ S N +I+MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYL 71 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N +++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 309 PSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYL 358 >ref|XP_004234063.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 6 [Solanum lycopersicum] Length = 244 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ S N +I+MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYL 71 >ref|XP_004234062.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 5 [Solanum lycopersicum] Length = 255 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ S N +I+MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYL 71 >ref|XP_004234058.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 1 [Solanum lycopersicum] gi|460376546|ref|XP_004234059.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 2 [Solanum lycopersicum] gi|460376548|ref|XP_004234060.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 3 [Solanum lycopersicum] gi|460376550|ref|XP_004234061.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform 4 [Solanum lycopersicum] Length = 267 Score = 66.2 bits (160), Expect = 1e-08 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ S N +I+MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYL 71 >dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 267 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N K++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEITGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYL 71 >sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor gi|19819|emb|CAA36955.1| unnamed protein product [Nicotiana tabacum] Length = 266 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N K++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 21 PSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYL 70 >dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 267 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N K++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYL 71 >sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding protein 50, chloroplastic; AltName: Full=LHCII type I CAB-50; Short=LHCP; Flags: Precursor gi|19833|emb|CAA36956.1| unnamed protein product [Nicotiana tabacum] Length = 267 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N K++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYL 71 >sp|P12470.1|CB25_NICPL RecName: Full=Chlorophyll a-b binding protein E, chloroplastic; AltName: Full=LHCII type I CAB-E; Short=LHCP; Flags: Precursor gi|170212|gb|AAA34056.1| chlorophyll a/b-binding protein-E [Nicotiana plumbaginifolia] Length = 266 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N K++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 21 PSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYL 70 >sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor gi|19829|emb|CAA36958.1| unnamed protein product [Nicotiana tabacum] Length = 267 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N K++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYL 71 >gb|ABQ32304.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Artemisia annua] Length = 254 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P+N N ++SMR SGSPWYGPDRVKYLGPFSGE+PSYL Sbjct: 9 PSNSELLGNGRVSMRKTAAPKKVAPSGSPWYGPDRVKYLGPFSGEAPSYL 58 >ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like [Solanum tuberosum] Length = 267 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N K+ MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEITGNGKVMMRKTVTKAKPISSGSPWYGPDRVKYLGPFSGESPSYL 71 >ref|XP_007221496.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica] gi|462418246|gb|EMJ22695.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica] Length = 265 Score = 65.1 bits (157), Expect = 3e-08 Identities = 33/59 (55%), Positives = 39/59 (66%) Frame = -2 Query: 750 VSLNSQSEFPTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 + LN+Q+EF T N ++SMR GSPWYGPDRVKYLGPFSGE+PSYL Sbjct: 15 IPLNTQTEFST---VQGNGRVSMRRAARKPAVSS-GSPWYGPDRVKYLGPFSGEAPSYL 69 >ref|XP_006356078.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Solanum tuberosum] Length = 267 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N +++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEVTGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYL 71 >ref|XP_006356077.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Solanum tuberosum] Length = 267 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N +++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEITGNGRVTMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGESPSYL 71 >ref|XP_006356076.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 267 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N +++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEVTGNGRVTMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGESPSYL 71 >ref|XP_006356075.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 267 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N +++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYL 71 >gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum lycopersicum] Length = 267 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N +++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYL 71 >sp|P07369.1|CB2G_SOLLC RecName: Full=Chlorophyll a-b binding protein 3C, chloroplastic; AltName: Full=LHCII type I CAB-3C; Short=LHCP; Flags: Precursor gi|224932|prf||1204205G protein 3C,chlorophyll binding Length = 267 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -2 Query: 723 PTNVRSSSNSKISMRXXXXXXXXXXSGSPWYGPDRVKYLGPFSGESPSYL 574 P++ + N +++MR SGSPWYGPDRVKYLGPFSGESPSYL Sbjct: 22 PSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYL 71