BLASTX nr result
ID: Papaver25_contig00003608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00003608 (1687 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828851.1| hypothetical protein AMTR_s00001p00157430 [A... 45 1e-07 emb|CAN66750.1| hypothetical protein VITISV_034413 [Vitis vinifera] 42 1e-06 ref|XP_003634352.1| PREDICTED: RNA pseudourine synthase 2, chlor... 42 1e-06 ref|XP_003563280.1| PREDICTED: RNA pseudourine synthase 2, chlor... 42 2e-06 ref|XP_004238386.1| PREDICTED: RNA pseudourine synthase 2, chlor... 44 2e-06 ref|XP_004966473.1| PREDICTED: RNA pseudouridine synthase 2, chl... 40 3e-06 gb|EMS58535.1| RNA pseudourine synthase 2, chloroplastic [Tritic... 40 5e-06 gb|EMT10334.1| RNA pseudourine synthase 2, chloroplastic [Aegilo... 40 6e-06 ref|XP_002439034.1| hypothetical protein SORBIDRAFT_10g030300 [S... 40 9e-06 >ref|XP_006828851.1| hypothetical protein AMTR_s00001p00157430 [Amborella trichopoda] gi|548833830|gb|ERM96267.1| hypothetical protein AMTR_s00001p00157430 [Amborella trichopoda] Length = 452 Score = 45.4 bits (106), Expect(2) = 1e-07 Identities = 20/35 (57%), Positives = 25/35 (71%) Frame = +1 Query: 946 ALSRLRHKTPSNMHNYLPELVDKFQRPCQHVYALG 1050 ALSRLR +TPS+ H L +LV QRPC H ++LG Sbjct: 367 ALSRLRPRTPSHYHGPLSQLVSNLQRPCLHAFSLG 401 Score = 39.3 bits (90), Expect(2) = 1e-07 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +2 Query: 875 IRAHAKHLGYPLLGDEVYVGTK 940 IR HAK++G PLLGDEVY GTK Sbjct: 343 IRVHAKYIGNPLLGDEVYGGTK 364 >emb|CAN66750.1| hypothetical protein VITISV_034413 [Vitis vinifera] Length = 611 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +2 Query: 875 IRAHAKHLGYPLLGDEVYVGTK 940 IRAHAK+LG PLLGDEVY GTK Sbjct: 481 IRAHAKYLGIPLLGDEVYGGTK 502 Score = 39.3 bits (90), Expect(2) = 1e-06 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = +1 Query: 946 ALSRLRHKTPSNMHNYLPELVDKFQRPCQHVYALG 1050 ALS LR + PS+ H L +LV + RPC H ALG Sbjct: 505 ALSLLRPRIPSSHHGQLAQLVSRLDRPCLHAVALG 539 >ref|XP_003634352.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Vitis vinifera] gi|302141717|emb|CBI18920.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +2 Query: 875 IRAHAKHLGYPLLGDEVYVGTK 940 IRAHAK+LG PLLGDEVY GTK Sbjct: 335 IRAHAKYLGIPLLGDEVYGGTK 356 Score = 39.3 bits (90), Expect(2) = 1e-06 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = +1 Query: 946 ALSRLRHKTPSNMHNYLPELVDKFQRPCQHVYALG 1050 ALS LR + PS+ H L +LV + RPC H ALG Sbjct: 359 ALSLLRPRIPSSHHGQLAQLVSRLDRPCLHAVALG 393 >ref|XP_003563280.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Brachypodium distachyon] Length = 439 Score = 42.0 bits (97), Expect(2) = 2e-06 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +2 Query: 875 IRAHAKHLGYPLLGDEVYVGTK 940 IRAHAK+LGYPLLGDE Y G+K Sbjct: 335 IRAHAKYLGYPLLGDETYGGSK 356 Score = 38.5 bits (88), Expect(2) = 2e-06 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +1 Query: 946 ALSRLRHKTPSNMHNYLPELVDKFQRPCQHVYALG 1050 ALS LR +TPS H L L+ K RPC H LG Sbjct: 359 ALSLLRPRTPSRYHGDLSNLISKIDRPCLHAALLG 393 >ref|XP_004238386.1| PREDICTED: RNA pseudourine synthase 2, chloroplastic-like [Solanum lycopersicum] Length = 436 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +2 Query: 875 IRAHAKHLGYPLLGDEVYVGTK 940 IRAHAKHLG PL+GDEVY GTK Sbjct: 337 IRAHAKHLGIPLMGDEVYGGTK 358 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +1 Query: 946 ALSRLRHKTPSNMHNYLPELVDKFQRPCQHVYALG 1050 ALS L+ KTP H L +LV + RPC H LG Sbjct: 361 ALSLLQPKTPPMFHGELSQLVSQIDRPCLHALTLG 395 >ref|XP_004966473.1| PREDICTED: RNA pseudouridine synthase 2, chloroplastic-like [Setaria italica] Length = 437 Score = 40.4 bits (93), Expect(2) = 3e-06 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +2 Query: 875 IRAHAKHLGYPLLGDEVYVGTK 940 IRAHAK+LG PLLGDE Y GTK Sbjct: 336 IRAHAKYLGIPLLGDETYGGTK 357 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = +1 Query: 946 ALSRLRHKTPSNMHNYLPELVDKFQRPCQHVYALG 1050 ALS LR +TPS H+ L +L+ K RPC H LG Sbjct: 360 ALSLLRPRTPSKYHSGLSDLISKVDRPCLHAALLG 394 >gb|EMS58535.1| RNA pseudourine synthase 2, chloroplastic [Triticum urartu] Length = 485 Score = 40.0 bits (92), Expect(2) = 5e-06 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +2 Query: 875 IRAHAKHLGYPLLGDEVYVGTK 940 IRAHAK+LG PLLGDE Y GTK Sbjct: 297 IRAHAKYLGNPLLGDETYGGTK 318 Score = 38.9 bits (89), Expect(2) = 5e-06 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = +1 Query: 946 ALSRLRHKTPSNMHNYLPELVDKFQRPCQHVYALG 1050 ALS LR +TPS H L LV K RPC H LG Sbjct: 321 ALSLLRPRTPSKYHGDLTNLVSKIDRPCLHAALLG 355 >gb|EMT10334.1| RNA pseudourine synthase 2, chloroplastic [Aegilops tauschii] Length = 220 Score = 40.4 bits (93), Expect(2) = 6e-06 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +2 Query: 875 IRAHAKHLGYPLLGDEVYVGTK 940 IRAHAK+LG PLLGDE Y GTK Sbjct: 162 IRAHAKYLGNPLLGDETYEGTK 183 Score = 38.5 bits (88), Expect(2) = 6e-06 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +1 Query: 946 ALSRLRHKTPSNMHNYLPELVDKFQRPCQHVYALG 1050 ALS LR +TPS H L L+ K RPC H LG Sbjct: 186 ALSLLRPRTPSKYHGDLSNLISKIDRPCLHAALLG 220 >ref|XP_002439034.1| hypothetical protein SORBIDRAFT_10g030300 [Sorghum bicolor] gi|241917257|gb|EER90401.1| hypothetical protein SORBIDRAFT_10g030300 [Sorghum bicolor] Length = 441 Score = 39.7 bits (91), Expect(2) = 9e-06 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +2 Query: 875 IRAHAKHLGYPLLGDEVYVGTK 940 IRAHAK++G PLLGDE Y GTK Sbjct: 341 IRAHAKYIGIPLLGDETYGGTK 362 Score = 38.5 bits (88), Expect(2) = 9e-06 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = +1 Query: 946 ALSRLRHKTPSNMHNYLPELVDKFQRPCQHVYALG 1050 ALS LR +TPS H+ L L+ K RPC H LG Sbjct: 365 ALSLLRPRTPSKYHSDLSNLISKVDRPCLHAALLG 399