BLASTX nr result
ID: Papaver25_contig00002349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00002349 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526390.1| PREDICTED: phosphatidylinositol/phosphatidyl... 59 7e-07 ref|XP_007148649.1| hypothetical protein PHAVU_005G003600g [Phas... 56 6e-06 >ref|XP_003526390.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH13-like isoform X1 [Glycine max] gi|571462928|ref|XP_006582422.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH13-like isoform X2 [Glycine max] Length = 620 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/60 (43%), Positives = 34/60 (56%) Frame = +3 Query: 3 CMCAAEGGCLRSNYGPWKDPDILKVMSSDTVAYCSDNDRIVGGSEALDCTREEALPEGQS 182 C CAAEGGCLRSN GPW DPDI+K++ ++ + R+ G D + L E S Sbjct: 316 CTCAAEGGCLRSNKGPWNDPDIMKLVHNEEATFVRQITRMPNGQHTFDSYQIPRLKERSS 375 >ref|XP_007148649.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris] gi|593696336|ref|XP_007148650.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris] gi|593696338|ref|XP_007148651.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris] gi|561021913|gb|ESW20643.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris] gi|561021914|gb|ESW20644.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris] gi|561021915|gb|ESW20645.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris] Length = 621 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/48 (43%), Positives = 32/48 (66%) Frame = +3 Query: 3 CMCAAEGGCLRSNYGPWKDPDILKVMSSDTVAYCSDNDRIVGGSEALD 146 C CA+EGGCLRSN GPW DPDI+K+++++ + ++ G + D Sbjct: 316 CTCASEGGCLRSNKGPWNDPDIMKLVNNEETKFVRQIIKVPDGQQKFD 363