BLASTX nr result
ID: Papaver25_contig00001080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00001080 (2062 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847862.1| hypothetical protein AMTR_s00029p00079800 [A... 59 7e-06 >ref|XP_006847862.1| hypothetical protein AMTR_s00029p00079800 [Amborella trichopoda] gi|548851167|gb|ERN09443.1| hypothetical protein AMTR_s00029p00079800 [Amborella trichopoda] Length = 1450 Score = 59.3 bits (142), Expect = 7e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +1 Query: 88 WLISMSRPEDWERGPDPRKYFVQFFGTAEINIGDGAEI 201 W +SRPEDWER PDPRKYFV+FFGTAEI A+I Sbjct: 34 WPAKISRPEDWERSPDPRKYFVEFFGTAEIAFVAPADI 71