BLASTX nr result
ID: Papaver25_contig00000922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00000922 (2133 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EWC86021.1| ribosomal protein L10.e [Plasmodium falciparum NF54] 68 1e-08 gb|EUD73737.1| 60S ribosomal protein L10 [Plasmodium vinckei pet... 68 1e-08 gb|ETW29209.1| 60S ribosomal protein [Plasmodium falciparum FCH/4] 68 1e-08 ref|XP_674994.1| ribosomal protein L10 [Plasmodium berghei strai... 68 1e-08 ref|XP_001348314.1| 60S ribosomal protein L10, putative [Plasmod... 68 1e-08 gb|EYU46038.1| hypothetical protein MIMGU_mgv1a010817mg [Mimulus... 68 2e-08 gb|EYU42429.1| hypothetical protein MIMGU_mgv1a012042mg [Mimulus... 68 2e-08 gb|EXB97298.1| 60S ribosomal protein L10 [Morus notabilis] 68 2e-08 gb|EXB97296.1| 60S ribosomal protein L10 [Morus notabilis] 68 2e-08 gb|EXB56028.1| 60S ribosomal protein L10 [Morus notabilis] 68 2e-08 sp|Q9SPB3.1|RL10_VITRI RecName: Full=60S ribosomal protein L10; ... 68 2e-08 ref|NP_174013.1| 60S ribosomal protein L10-2 [Arabidopsis thalia... 68 2e-08 gb|EUD65984.1| 60S ribosomal protein L10-like protein [Plasmodiu... 68 2e-08 ref|XP_006659182.1| PREDICTED: 60S ribosomal protein L10-2-like ... 68 2e-08 ref|XP_006655035.1| PREDICTED: 60S ribosomal protein L10-2-like ... 68 2e-08 ref|XP_003553186.2| PREDICTED: 60S ribosomal protein L10 [Glycin... 68 2e-08 ref|XP_006344088.1| PREDICTED: 60S ribosomal protein L10-like [S... 68 2e-08 ref|XP_007146907.1| hypothetical protein PHAVU_006G080600g [Phas... 68 2e-08 ref|XP_007141334.1| hypothetical protein PHAVU_008G187000g [Phas... 68 2e-08 ref|XP_007141333.1| hypothetical protein PHAVU_008G187000g [Phas... 68 2e-08 >gb|EWC86021.1| ribosomal protein L10.e [Plasmodium falciparum NF54] Length = 144 Score = 68.2 bits (165), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 16 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 46 >gb|EUD73737.1| 60S ribosomal protein L10 [Plasmodium vinckei petteri] Length = 219 Score = 68.2 bits (165), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >gb|ETW29209.1| 60S ribosomal protein [Plasmodium falciparum FCH/4] Length = 313 Score = 68.2 bits (165), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >ref|XP_674994.1| ribosomal protein L10 [Plasmodium berghei strain ANKA] gi|56493916|emb|CAI00161.1| ribosomal protein L10, putative [Plasmodium berghei] Length = 219 Score = 68.2 bits (165), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >ref|XP_001348314.1| 60S ribosomal protein L10, putative [Plasmodium falciparum 3D7] gi|23497206|gb|AAN36753.1| 60S ribosomal protein L10, putative [Plasmodium falciparum 3D7] gi|574747852|gb|ETW16227.1| 60S ribosomal protein L10-like protein [Plasmodium falciparum Vietnam Oak-Knoll (FVO)] gi|574978509|gb|ETW40298.1| 60S ribosomal protein L10-like protein [Plasmodium falciparum NF135/5.C10] gi|574984174|gb|ETW45825.1| 60S ribosomal protein L10-like protein [Plasmodium falciparum MaliPS096_E11] gi|574992663|gb|ETW53779.1| 60S ribosomal protein L10-like protein [Plasmodium falciparum Palo Alto/Uganda] gi|574998416|gb|ETW58925.1| 60S ribosomal protein L10-like protein [Plasmodium falciparum CAMP/Malaysia] gi|579098933|gb|EUR47990.1| 60S ribosomal protein L10-like protein, partial [Plasmodium falciparum 7G8] gi|579327697|gb|EUT78637.1| 60S ribosomal protein L10-like protein [Plasmodium falciparum Santa Lucia] gi|583212302|gb|EWC74047.1| 60S ribosomal protein L10-like protein [Plasmodium falciparum UGT5.1] Length = 219 Score = 68.2 bits (165), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >gb|EYU46038.1| hypothetical protein MIMGU_mgv1a010817mg [Mimulus guttatus] Length = 301 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 165 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 195 >gb|EYU42429.1| hypothetical protein MIMGU_mgv1a012042mg [Mimulus guttatus] Length = 263 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 134 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 164 >gb|EXB97298.1| 60S ribosomal protein L10 [Morus notabilis] Length = 233 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >gb|EXB97296.1| 60S ribosomal protein L10 [Morus notabilis] Length = 574 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 445 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 475 >gb|EXB56028.1| 60S ribosomal protein L10 [Morus notabilis] Length = 220 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >sp|Q9SPB3.1|RL10_VITRI RecName: Full=60S ribosomal protein L10; AltName: Full=QM protein homolog gi|5917743|gb|AAD56018.1|AF180758_1 60S ribosomal protein L10 [Vitis riparia] Length = 220 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >ref|NP_174013.1| 60S ribosomal protein L10-2 [Arabidopsis thaliana] gi|19884272|sp|Q08770.2|RL102_ARATH RecName: Full=60S ribosomal protein L10-2; AltName: Full=Wilms tumor suppressor protein homolog gi|4262180|gb|AAD14497.1| 60s ribosomal protein L10 [Arabidopsis thaliana] gi|21592869|gb|AAM64819.1| putative 60s ribosomal protein L10 [Arabidopsis thaliana] gi|88196721|gb|ABD43003.1| At1g26910 [Arabidopsis thaliana] gi|332192636|gb|AEE30757.1| 60S ribosomal protein L10-2 [Arabidopsis thaliana] Length = 221 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >gb|EUD65984.1| 60S ribosomal protein L10-like protein [Plasmodium inui San Antonio 1] Length = 219 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >ref|XP_006659182.1| PREDICTED: 60S ribosomal protein L10-2-like [Oryza brachyantha] Length = 222 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >ref|XP_006655035.1| PREDICTED: 60S ribosomal protein L10-2-like [Oryza brachyantha] Length = 305 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 174 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 204 >ref|XP_003553186.2| PREDICTED: 60S ribosomal protein L10 [Glycine max] Length = 263 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 134 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 164 >ref|XP_006344088.1| PREDICTED: 60S ribosomal protein L10-like [Solanum tuberosum] Length = 220 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >ref|XP_007146907.1| hypothetical protein PHAVU_006G080600g [Phaseolus vulgaris] gi|561020130|gb|ESW18901.1| hypothetical protein PHAVU_006G080600g [Phaseolus vulgaris] Length = 220 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >ref|XP_007141334.1| hypothetical protein PHAVU_008G187000g [Phaseolus vulgaris] gi|561014467|gb|ESW13328.1| hypothetical protein PHAVU_008G187000g [Phaseolus vulgaris] Length = 221 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 91 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 121 >ref|XP_007141333.1| hypothetical protein PHAVU_008G187000g [Phaseolus vulgaris] gi|561014466|gb|ESW13327.1| hypothetical protein PHAVU_008G187000g [Phaseolus vulgaris] Length = 223 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2039 IHPFHVLRINKMLSCAGADRLQTGMRGAFGK 2131 +HPFHVLRINKMLSCAGADRLQTGMRGAFGK Sbjct: 93 VHPFHVLRINKMLSCAGADRLQTGMRGAFGK 123