BLASTX nr result
ID: Papaver25_contig00000159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00000159 (730 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB66327.1| Aspartic proteinase [Morus notabilis] 76 1e-11 ref|XP_003632941.1| PREDICTED: aspartic proteinase isoform 2 [Vi... 76 1e-11 emb|CBI23210.3| unnamed protein product [Vitis vinifera] 76 1e-11 ref|XP_002518445.1| Aspartic proteinase precursor, putative [Ric... 75 2e-11 gb|ACX55830.1| aspartic proteinase 2 [Castanea mollissima] 74 5e-11 gb|ACX55829.1| aspartic proteinase 1 [Castanea mollissima] 74 5e-11 gb|ABI78942.1| aspartic protease [Ipomoea batatas] 74 5e-11 ref|XP_006840365.1| hypothetical protein AMTR_s00045p00122510 [A... 74 7e-11 ref|XP_007049085.1| Aspartic protease isoform 2 [Theobroma cacao... 74 7e-11 ref|XP_007049084.1| Aspartic proteinase A1 isoform 1 [Theobroma ... 74 7e-11 ref|XP_007211824.1| hypothetical protein PRUPE_ppa004375mg [Prun... 74 7e-11 gb|AFH58568.1| aspartic acid protease [Ananas comosus] 74 7e-11 gb|ABG37021.1| aspartic protease [Nicotiana tabacum] 74 7e-11 gb|AAK55849.1|AF266465_1 aspartic protease [Manihot esculenta] 73 9e-11 gb|EYU33885.1| hypothetical protein MIMGU_mgv1a004716mg [Mimulus... 73 1e-10 ref|XP_006350474.1| PREDICTED: aspartic proteinase-like [Solanum... 73 1e-10 gb|EPS60672.1| aspartic proteinase 1, partial [Genlisea aurea] 73 1e-10 ref|XP_004969436.1| PREDICTED: aspartic proteinase oryzasin-1-li... 73 1e-10 ref|XP_007211538.1| hypothetical protein PRUPE_ppa003924mg [Prun... 73 1e-10 ref|XP_004231616.1| PREDICTED: aspartic proteinase A1-like [Sola... 73 1e-10 >gb|EXB66327.1| Aspartic proteinase [Morus notabilis] Length = 514 Score = 76.3 bits (186), Expect = 1e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG+YHTVFDYGNMRIGFAEAA Sbjct: 480 PPPRGPLWILGDVFMGRYHTVFDYGNMRIGFAEAA 514 >ref|XP_003632941.1| PREDICTED: aspartic proteinase isoform 2 [Vitis vinifera] gi|359483347|ref|XP_002262915.2| PREDICTED: aspartic proteinase isoform 1 [Vitis vinifera] Length = 514 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG+YHTVFDYGNMR+GFAEAA Sbjct: 480 PPPRGPLWILGDVFMGRYHTVFDYGNMRVGFAEAA 514 >emb|CBI23210.3| unnamed protein product [Vitis vinifera] Length = 429 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG+YHTVFDYGNMR+GFAEAA Sbjct: 395 PPPRGPLWILGDVFMGRYHTVFDYGNMRVGFAEAA 429 >ref|XP_002518445.1| Aspartic proteinase precursor, putative [Ricinus communis] gi|223542290|gb|EEF43832.1| Aspartic proteinase precursor, putative [Ricinus communis] Length = 511 Score = 75.1 bits (183), Expect = 2e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGDIFMG+YHTVFDYGN+R+GFAEAA Sbjct: 477 PPPRGPLWILGDIFMGRYHTVFDYGNLRVGFAEAA 511 >gb|ACX55830.1| aspartic proteinase 2 [Castanea mollissima] Length = 513 Score = 73.9 bits (180), Expect = 5e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG+YHTVFDYGN R+GFAEAA Sbjct: 479 PPPRGPLWILGDVFMGRYHTVFDYGNQRVGFAEAA 513 >gb|ACX55829.1| aspartic proteinase 1 [Castanea mollissima] Length = 513 Score = 73.9 bits (180), Expect = 5e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG+YHTVFDYGN R+GFAEAA Sbjct: 479 PPPRGPLWILGDVFMGRYHTVFDYGNQRVGFAEAA 513 >gb|ABI78942.1| aspartic protease [Ipomoea batatas] Length = 508 Score = 73.9 bits (180), Expect = 5e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 PAPRGPLWILGD+FMG YHTVFDYGN++IGFAEAA Sbjct: 474 PAPRGPLWILGDVFMGVYHTVFDYGNLQIGFAEAA 508 >ref|XP_006840365.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda] gi|548842083|gb|ERN02040.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda] Length = 510 Score = 73.6 bits (179), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG YHTVFDYGN+R+GFAEAA Sbjct: 476 PPPRGPLWILGDVFMGAYHTVFDYGNLRVGFAEAA 510 >ref|XP_007049085.1| Aspartic protease isoform 2 [Theobroma cacao] gi|508701346|gb|EOX93242.1| Aspartic protease isoform 2 [Theobroma cacao] Length = 514 Score = 73.6 bits (179), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG+YHTVFDYGNM +GFAEAA Sbjct: 480 PPPRGPLWILGDVFMGRYHTVFDYGNMTVGFAEAA 514 >ref|XP_007049084.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao] gi|508701345|gb|EOX93241.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao] Length = 550 Score = 73.6 bits (179), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG+YHTVFDYGNM +GFAEAA Sbjct: 516 PPPRGPLWILGDVFMGRYHTVFDYGNMTVGFAEAA 550 >ref|XP_007211824.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica] gi|462407689|gb|EMJ13023.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica] Length = 514 Score = 73.6 bits (179), Expect = 7e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG+YHTVFDYGN RIGFAEAA Sbjct: 480 PPPRGPLWILGDVFMGRYHTVFDYGNERIGFAEAA 514 >gb|AFH58568.1| aspartic acid protease [Ananas comosus] Length = 514 Score = 73.6 bits (179), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG YHTVFDYGNMR+GFA+AA Sbjct: 480 PPPRGPLWILGDVFMGAYHTVFDYGNMRVGFADAA 514 >gb|ABG37021.1| aspartic protease [Nicotiana tabacum] Length = 508 Score = 73.6 bits (179), Expect = 7e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG+YHTVFDYGN R+GFAEAA Sbjct: 474 PPPRGPLWILGDVFMGRYHTVFDYGNSRVGFAEAA 508 >gb|AAK55849.1|AF266465_1 aspartic protease [Manihot esculenta] Length = 159 Score = 73.2 bits (178), Expect = 9e-11 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGD+FMG++HTVFDYGN+R+GFAEAA Sbjct: 125 PPPRGPLWILGDVFMGRFHTVFDYGNLRVGFAEAA 159 >gb|EYU33885.1| hypothetical protein MIMGU_mgv1a004716mg [Mimulus guttatus] Length = 513 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGDIFMG+YHTVFDYG +R+GFAEAA Sbjct: 479 PPPRGPLWILGDIFMGRYHTVFDYGKLRVGFAEAA 513 >ref|XP_006350474.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum] Length = 510 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGDIFMG+YHTVFDYG +R+GFAEAA Sbjct: 476 PPPRGPLWILGDIFMGRYHTVFDYGKLRVGFAEAA 510 >gb|EPS60672.1| aspartic proteinase 1, partial [Genlisea aurea] Length = 146 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGDIFMG+YHTVFDY N+R+GFAEAA Sbjct: 112 PPPRGPLWILGDIFMGRYHTVFDYANLRVGFAEAA 146 >ref|XP_004969436.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica] Length = 507 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGDIFMG YHTVFDYGN+++GFAEAA Sbjct: 473 PPPRGPLWILGDIFMGAYHTVFDYGNLKVGFAEAA 507 >ref|XP_007211538.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica] gi|462407403|gb|EMJ12737.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica] Length = 539 Score = 72.8 bits (177), Expect = 1e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGDIFMG+YHTVFD GNMR+GFAEAA Sbjct: 505 PPPRGPLWILGDIFMGRYHTVFDSGNMRVGFAEAA 539 >ref|XP_004231616.1| PREDICTED: aspartic proteinase A1-like [Solanum lycopersicum] Length = 510 Score = 72.8 bits (177), Expect = 1e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 728 PAPRGPLWILGDIFMGKYHTVFDYGNMRIGFAEAA 624 P PRGPLWILGDIFMG+YHTVFDYG +R+GFAEAA Sbjct: 476 PPPRGPLWILGDIFMGRYHTVFDYGKLRVGFAEAA 510