BLASTX nr result
ID: Papaver25_contig00000112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00000112 (2266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003540978.1| hypothetical chloroplast RF68 [Phoenix dacty... 59 1e-05 >ref|YP_003540978.1| hypothetical chloroplast RF68 [Phoenix dactylifera] gi|292559577|ref|YP_003540992.1| hypothetical chloroplast RF68 [Phoenix dactylifera] gi|377819425|ref|YP_005097920.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|377819438|ref|YP_005097933.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|294620624|gb|ADF28193.1| hypothetical chloroplast RF68 (chloroplast) [Phoenix dactylifera] gi|294620638|gb|ADF28207.1| hypothetical chloroplast RF68 (chloroplast) [Phoenix dactylifera] gi|340536686|gb|AEK48453.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|340536699|gb|AEK48466.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|340536773|gb|AEK48539.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|340536786|gb|AEK48552.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] Length = 114 Score = 58.9 bits (141), Expect = 1e-05 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 2000 RKLSSRESIHPLSVYV*LSLEHMFRFGLSGKMEH 1899 R LSSRESIHPLSVY LSLEH FRFGL+GKMEH Sbjct: 38 RLLSSRESIHPLSVYGQLSLEHRFRFGLNGKMEH 71