BLASTX nr result
ID: Papaver25_contig00000023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00000023 (529 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006837039.1| hypothetical protein AMTR_s00110p00041250 [A... 64 2e-08 emb|CAN59984.1| hypothetical protein VITISV_042692 [Vitis vinifera] 60 4e-07 >ref|XP_006837039.1| hypothetical protein AMTR_s00110p00041250 [Amborella trichopoda] gi|548839632|gb|ERM99892.1| hypothetical protein AMTR_s00110p00041250 [Amborella trichopoda] Length = 1847 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +2 Query: 2 KTCEDWAVKHNLPAAEASSSFMLHSRFPSAFIDKAEEFFSS 124 K CE+W K +LP +E SSS MLHSRFPS+F+D+AEEFF+S Sbjct: 1804 KVCEEWPPKRSLPVSEVSSSLMLHSRFPSSFLDRAEEFFAS 1844 >emb|CAN59984.1| hypothetical protein VITISV_042692 [Vitis vinifera] Length = 312 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +2 Query: 2 KTCEDWAVKHNLPAAEASSSFMLHSRFPSAFIDKAEEFFSS 124 KTCE+ A+KHN+ A E S+ MLH RFPS+F+D+AE+FFS+ Sbjct: 174 KTCEEMALKHNMQAPETPSALMLHFRFPSSFMDRAEQFFSA 214