BLASTX nr result
ID: Papaver23_contig00035840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00035840 (494 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615696.1| Pentatricopeptide repeat-containing protein ... 70 1e-10 ref|NP_173402.2| pentatricopeptide repeat-containing protein [Ar... 69 4e-10 emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] 69 4e-10 emb|CBI19766.3| unnamed protein product [Vitis vinifera] 65 6e-09 gb|EEC76380.1| hypothetical protein OsI_13992 [Oryza sativa Indi... 57 1e-06 >ref|XP_003615696.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355517031|gb|AES98654.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 887 Score = 70.5 bits (171), Expect = 1e-10 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 3 HKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 113 H TAK+IS+ YGCEIYL+D CLHHFK G CSC+DYW Sbjct: 851 HDTAKYISMAYGCEIYLSDSNCLHHFKGGHCSCRDYW 887 >ref|NP_173402.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75263158|sp|Q9FXH1.1|PPR52_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g19720; AltName: Full=Protein DYW7 gi|10086495|gb|AAG12555.1|AC007797_15 Unknown Protein [Arabidopsis thaliana] gi|332191770|gb|AEE29891.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 894 Score = 68.9 bits (167), Expect = 4e-10 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 HKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 113 H TAK++S RYGC+I L D +CLHHFK+G CSCKDYW Sbjct: 858 HDTAKYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 894 >emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] Length = 406 Score = 68.9 bits (167), Expect = 4e-10 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 3 HKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 113 H TAK++S RYGC+I L D +CLHHFK+G CSCKDYW Sbjct: 370 HDTAKYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 406 >emb|CBI19766.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 65.1 bits (157), Expect = 6e-09 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +3 Query: 3 HKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 113 H TAKF+S+ Y CEIYL+D KCLH FK+G CSC DYW Sbjct: 458 HGTAKFLSMLYSCEIYLSDSKCLHWFKNGRCSCGDYW 494 >gb|EEC76380.1| hypothetical protein OsI_13992 [Oryza sativa Indica Group] Length = 822 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = +3 Query: 3 HKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 113 H AK +S +YG I + DPKCLH F+DG CSC+DYW Sbjct: 786 HTFAKLVSEKYGRHILIKDPKCLHKFEDGKCSCEDYW 822