BLASTX nr result
ID: Papaver23_contig00035459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00035459 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610566.1| Pentatricopeptide repeat-containing protein ... 88 8e-16 ref|XP_003593079.1| Pentatricopeptide repeat-containing protein ... 83 2e-14 ref|XP_003518279.1| PREDICTED: putative pentatricopeptide repeat... 78 7e-13 ref|XP_004165422.1| PREDICTED: putative pentatricopeptide repeat... 71 8e-11 ref|XP_004141212.1| PREDICTED: putative pentatricopeptide repeat... 71 8e-11 >ref|XP_003610566.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355511621|gb|AES92763.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 598 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/66 (60%), Positives = 50/66 (75%) Frame = +1 Query: 1 VLASGFTFSSVLNACARIPAVREGKMIHARVVESGFLGSKVIGTTLVDMYGKCGGSIDGN 180 +L SGFTFSSVLNAC R+PAV EGK +HAR+V+SGFLG+K++ T L+DMY KCG D Sbjct: 111 ILPSGFTFSSVLNACGRVPAVFEGKQVHARLVQSGFLGNKIVQTALLDMYAKCGYVCDAR 170 Query: 181 GNDDAL 198 D + Sbjct: 171 DVFDGM 176 >ref|XP_003593079.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|124360447|gb|ABN08457.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355482127|gb|AES63330.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 558 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/66 (57%), Positives = 48/66 (72%) Frame = +1 Query: 1 VLASGFTFSSVLNACARIPAVREGKMIHARVVESGFLGSKVIGTTLVDMYGKCGGSIDGN 180 +L SGFTFS VLNAC R+PA EGK +HAR+V+SGFLG+K++ T L+DMY KCG D Sbjct: 111 ILPSGFTFSLVLNACGRVPAGFEGKQVHARLVQSGFLGNKIVQTALLDMYAKCGHVCDAR 170 Query: 181 GNDDAL 198 D + Sbjct: 171 DVFDGI 176 >ref|XP_003518279.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570-like [Glycine max] Length = 552 Score = 78.2 bits (191), Expect = 7e-13 Identities = 38/68 (55%), Positives = 50/68 (73%), Gaps = 4/68 (5%) Frame = +1 Query: 1 VLASGFTFSSVLNACARIPAVREGKMIHARVVESGFLGSKVIGTTLVDMYGKCGGSIDG- 177 VL SGFTFSS+L+AC R+PA+ EGK +HARV++SGF G+K++ T L+DMY K G D Sbjct: 108 VLPSGFTFSSILSACGRVPALFEGKQVHARVMQSGFHGNKIVQTALLDMYAKSGCISDAR 167 Query: 178 ---NGNDD 192 +G DD Sbjct: 168 AVFDGMDD 175 >ref|XP_004165422.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570-like [Cucumis sativus] Length = 427 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/58 (55%), Positives = 46/58 (79%) Frame = +1 Query: 1 VLASGFTFSSVLNACARIPAVREGKMIHARVVESGFLGSKVIGTTLVDMYGKCGGSID 174 +L S FTFSSVL+A AR+PA+ G+ +HARV++ GFL +K++ T+L+DMY KCG +D Sbjct: 12 ILESEFTFSSVLSASARMPALYLGRQVHARVIQLGFLSNKIVLTSLMDMYAKCGFILD 69 >ref|XP_004141212.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570-like [Cucumis sativus] Length = 456 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/58 (55%), Positives = 46/58 (79%) Frame = +1 Query: 1 VLASGFTFSSVLNACARIPAVREGKMIHARVVESGFLGSKVIGTTLVDMYGKCGGSID 174 +L S FTFSSVL+A AR+PA+ G+ +HARV++ GFL +K++ T+L+DMY KCG +D Sbjct: 12 ILESEFTFSSVLSASARMPALYLGRQVHARVIQLGFLSNKIVLTSLMDMYAKCGFILD 69