BLASTX nr result
ID: Papaver23_contig00035281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00035281 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516804.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002516804.1| conserved hypothetical protein [Ricinus communis] gi|223543892|gb|EEF45418.1| conserved hypothetical protein [Ricinus communis] Length = 316 Score = 59.3 bits (142), Expect = 3e-07 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 4/117 (3%) Frame = +2 Query: 26 VGVWGDCIGVTCVWGPVRTEVWVMQEYGIRESWIR----KYTRTPSRRELLVSVGPLVPY 193 +GV C+ V C + VR + WVM+EYG+RESWIR Y P L SV Sbjct: 207 LGVLDGCLCVMCNYHAVRADFWVMKEYGVRESWIRLVTVPYLDYPGSLHLQYSV------ 260 Query: 194 WQPLWCFNNGEILVNNCCETLLLYNPTNETVKSVRSVVVRDIIMGKNRESYVESIVS 364 P +NGE+L+ +L++YNP T K V+ + + E Y++S+VS Sbjct: 261 --PYAIADNGEVLL-EFKSSLVIYNPNYGTFK---YPVINNSCSWVDAEVYIDSLVS 311