BLASTX nr result
ID: Papaver23_contig00034996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00034996 (659 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309380.1| predicted protein [Populus trichocarpa] gi|2... 46 5e-07 ref|XP_002528210.1| Auxin-induced protein 5NG4, putative [Ricinu... 45 6e-06 >ref|XP_002309380.1| predicted protein [Populus trichocarpa] gi|222855356|gb|EEE92903.1| predicted protein [Populus trichocarpa] Length = 348 Score = 45.8 bits (107), Expect(2) = 5e-07 Identities = 21/39 (53%), Positives = 31/39 (79%) Frame = -2 Query: 298 LKKHDIRRLSTLAKIVGTVICVS*SFCIAFMEGPKPLNT 182 L+K ++R L T++KI+GTVICVS + +A ++GPK LNT Sbjct: 101 LEKVNVRSLRTISKILGTVICVSGAIAMALLKGPKLLNT 139 Score = 33.5 bits (75), Expect(2) = 5e-07 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 141 FWNLKWQILQVPTSASCTNFVYS 73 FW+L W +LQVP SASC + +YS Sbjct: 168 FWSL-WMVLQVPISASCPDHLYS 189 >ref|XP_002528210.1| Auxin-induced protein 5NG4, putative [Ricinus communis] gi|223532371|gb|EEF34167.1| Auxin-induced protein 5NG4, putative [Ricinus communis] Length = 380 Score = 45.4 bits (106), Expect(2) = 6e-06 Identities = 28/75 (37%), Positives = 43/75 (57%) Frame = -2 Query: 406 GL*HESPTGTIDKKIVVVKFAFEIAIIFFRWYSENKLKKHDIRRLSTLAKIVGTVICVS* 227 GL S T T ++ F +A IF ++K +IR L ++AKI+GTVICV+ Sbjct: 95 GLFLTSSTATTAMTNLIPAITFVMAAIF-------GMEKVNIRNLRSIAKIIGTVICVTG 147 Query: 226 SFCIAFMEGPKPLNT 182 + +A ++GPK LN+ Sbjct: 148 AISMALLKGPKLLNS 162 Score = 30.4 bits (67), Expect(2) = 6e-06 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 141 FWNLKWQILQVPTSASCTNFVYS 73 FW+ W ILQVP S SC + +YS Sbjct: 191 FWSF-WMILQVPISESCPDHLYS 212