BLASTX nr result
ID: Papaver23_contig00034992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00034992 (662 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518333.1| PREDICTED: E3 ubiquitin-protein ligase liste... 77 3e-12 ref|XP_003615959.1| RING finger protein [Medicago truncatula] gi... 77 4e-12 ref|XP_004168686.1| PREDICTED: E3 ubiquitin-protein ligase liste... 76 5e-12 ref|XP_004154184.1| PREDICTED: E3 ubiquitin-protein ligase liste... 76 5e-12 ref|XP_004145301.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 76 5e-12 >ref|XP_003518333.1| PREDICTED: E3 ubiquitin-protein ligase listerin-like [Glycine max] Length = 1885 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/68 (51%), Positives = 42/68 (61%) Frame = -1 Query: 206 ASVEEKGPSQRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSI 27 A E G +RN KE + VEECPIC S I + P ++C TCKHKFH +C+ KWFS Sbjct: 1813 ALAEAIGIWKRNFDKEFEGVEECPICYSVIHTTNHGLPRLACKTCKHKFHSACLYKWFST 1872 Query: 26 SKNSICPL 3 S S CPL Sbjct: 1873 SHKSSCPL 1880 >ref|XP_003615959.1| RING finger protein [Medicago truncatula] gi|355517294|gb|AES98917.1| RING finger protein [Medicago truncatula] Length = 1683 Score = 76.6 bits (187), Expect = 4e-12 Identities = 35/68 (51%), Positives = 42/68 (61%) Frame = -1 Query: 206 ASVEEKGPSQRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSI 27 A E G +RN KE + VEECPIC S I + P ++C TCKHKFH +C+ KWFS Sbjct: 1611 ALAEAIGIWKRNFDKEFEGVEECPICYSVIHTTNHGLPRLACRTCKHKFHSACLYKWFST 1670 Query: 26 SKNSICPL 3 S S CPL Sbjct: 1671 SHKSSCPL 1678 >ref|XP_004168686.1| PREDICTED: E3 ubiquitin-protein ligase listerin-like [Cucumis sativus] Length = 120 Score = 76.3 bits (186), Expect = 5e-12 Identities = 33/59 (55%), Positives = 39/59 (66%) Frame = -1 Query: 179 QRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSISKNSICPL 3 +RN KE + VEECPIC S I S P ++C TCKHKFH +C+ KWFS S S CPL Sbjct: 57 KRNFDKEFEGVEECPICYSVIHTVNHSIPRLACKTCKHKFHSACLYKWFSTSHKSTCPL 115 >ref|XP_004154184.1| PREDICTED: E3 ubiquitin-protein ligase listerin-like, partial [Cucumis sativus] Length = 1660 Score = 76.3 bits (186), Expect = 5e-12 Identities = 33/59 (55%), Positives = 39/59 (66%) Frame = -1 Query: 179 QRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSISKNSICPL 3 +RN KE + VEECPIC S I S P ++C TCKHKFH +C+ KWFS S S CPL Sbjct: 1597 KRNFDKEFEGVEECPICYSVIHTVNHSIPRLACKTCKHKFHSACLYKWFSTSHKSTCPL 1655 >ref|XP_004145301.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase listerin-like [Cucumis sativus] Length = 1919 Score = 76.3 bits (186), Expect = 5e-12 Identities = 33/59 (55%), Positives = 39/59 (66%) Frame = -1 Query: 179 QRNLVKELKSVEECPICISRIRLSKQSRPSVSCDTCKHKFHLSCISKWFSISKNSICPL 3 +RN KE + VEECPIC S I S P ++C TCKHKFH +C+ KWFS S S CPL Sbjct: 1856 KRNFDKEFEGVEECPICYSVIHTVNHSIPRLACKTCKHKFHSACLYKWFSTSHKSTCPL 1914