BLASTX nr result
ID: Papaver23_contig00034858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00034858 (530 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284592.2| PREDICTED: pentatricopeptide repeat-containi... 146 2e-33 ref|XP_003526650.1| PREDICTED: pentatricopeptide repeat-containi... 133 1e-29 ref|XP_002520317.1| pentatricopeptide repeat-containing protein,... 122 3e-26 gb|AAG29201.1|AC078898_11 hypothetical protein [Arabidopsis thal... 119 3e-25 ref|NP_177860.2| pentatricopeptide repeat-containing protein [Ar... 119 3e-25 >ref|XP_002284592.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Vitis vinifera] Length = 476 Score = 146 bits (368), Expect = 2e-33 Identities = 68/97 (70%), Positives = 81/97 (83%) Frame = +3 Query: 180 EILDPTSKLCKIMIRCPKVGLEASLNESGIKVSTEMVEDVLHRFENGGMQAYKFFEWAQK 359 E DPT ++CKIMI CPK+ L+ SL+ESGI+VS +VE+VL RFEN GM AY+FFEWA K Sbjct: 10 ETADPTKRICKIMISCPKLELDTSLSESGIRVSPIVVENVLKRFENAGMLAYQFFEWAGK 69 Query: 360 QKYYTHSVRAYHIMIGSLAKVRQYQIMWDLVNKMRDI 470 Q+ YTHS+RAYH MI SLAK+RQYQIMWDLVNKMR + Sbjct: 70 QRNYTHSIRAYHTMIESLAKIRQYQIMWDLVNKMRSL 106 >ref|XP_003526650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Glycine max] Length = 461 Score = 133 bits (335), Expect = 1e-29 Identities = 56/104 (53%), Positives = 85/104 (81%) Frame = +3 Query: 162 SSGLGNEILDPTSKLCKIMIRCPKVGLEASLNESGIKVSTEMVEDVLHRFENGGMQAYKF 341 S + ++ + + ++CK+M+ CP +GL+ +LN++G++VS ++VE+VL RFEN GM A++F Sbjct: 5 SEAMIQDVGEASERVCKVMMTCPTLGLDTALNQTGVRVSPDLVENVLKRFENAGMPAFRF 64 Query: 342 FEWAQKQKYYTHSVRAYHIMIGSLAKVRQYQIMWDLVNKMRDIG 473 FEWA+KQ+ Y+HS+RAYH+MI SLAK+RQYQI+WDLV+ MR G Sbjct: 65 FEWAEKQRGYSHSIRAYHLMIESLAKIRQYQIVWDLVSAMRKKG 108 >ref|XP_002520317.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540536|gb|EEF42103.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 439 Score = 122 bits (306), Expect = 3e-26 Identities = 56/83 (67%), Positives = 69/83 (83%) Frame = +3 Query: 216 MIRCPKVGLEASLNESGIKVSTEMVEDVLHRFENGGMQAYKFFEWAQKQKYYTHSVRAYH 395 M+ P V L +L+++GI+VS E+VEDVL RFEN GM AY+FFEWA+KQ +YTHSVRAYH Sbjct: 1 MMSSPAVTLHTALDQNGIRVSPEIVEDVLRRFENAGMVAYRFFEWAEKQLHYTHSVRAYH 60 Query: 396 IMIGSLAKVRQYQIMWDLVNKMR 464 MI SLAK+RQYQIMWDL+N M+ Sbjct: 61 TMIESLAKIRQYQIMWDLINAMK 83 >gb|AAG29201.1|AC078898_11 hypothetical protein [Arabidopsis thaliana] Length = 481 Score = 119 bits (298), Expect = 3e-25 Identities = 50/101 (49%), Positives = 79/101 (78%) Frame = +3 Query: 162 SSGLGNEILDPTSKLCKIMIRCPKVGLEASLNESGIKVSTEMVEDVLHRFENGGMQAYKF 341 SS ++ D + K+++ P++ L+++L++SG++VS E+VEDVL+RF N G+ Y+F Sbjct: 25 SSEQVRDVADVAKNISKVLMSSPQLVLDSALDQSGLRVSQEVVEDVLNRFRNAGLLTYRF 84 Query: 342 FEWAQKQKYYTHSVRAYHIMIGSLAKVRQYQIMWDLVNKMR 464 F+W++KQ++Y HSVRAYH+MI S AK+RQY++MWDL+N MR Sbjct: 85 FQWSEKQRHYEHSVRAYHMMIESTAKIRQYKLMWDLINAMR 125 >ref|NP_177860.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806398|sp|Q9FVX2.2|PP129_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g77360, mitochondrial; Flags: Precursor gi|332197848|gb|AEE35969.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 517 Score = 119 bits (298), Expect = 3e-25 Identities = 50/101 (49%), Positives = 79/101 (78%) Frame = +3 Query: 162 SSGLGNEILDPTSKLCKIMIRCPKVGLEASLNESGIKVSTEMVEDVLHRFENGGMQAYKF 341 SS ++ D + K+++ P++ L+++L++SG++VS E+VEDVL+RF N G+ Y+F Sbjct: 61 SSEQVRDVADVAKNISKVLMSSPQLVLDSALDQSGLRVSQEVVEDVLNRFRNAGLLTYRF 120 Query: 342 FEWAQKQKYYTHSVRAYHIMIGSLAKVRQYQIMWDLVNKMR 464 F+W++KQ++Y HSVRAYH+MI S AK+RQY++MWDL+N MR Sbjct: 121 FQWSEKQRHYEHSVRAYHMMIESTAKIRQYKLMWDLINAMR 161