BLASTX nr result
ID: Papaver23_contig00034322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00034322 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN59965.1| hypothetical protein VITISV_022758 [Vitis vinifera] 55 6e-06 ref|XP_002466824.1| hypothetical protein SORBIDRAFT_01g014740 [S... 55 8e-06 >emb|CAN59965.1| hypothetical protein VITISV_022758 [Vitis vinifera] Length = 908 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 4/73 (5%) Frame = +2 Query: 290 RSLWYGILKAGADFHESVTLQVKNGKSIRFWHDWWNEKRAFKDKYPRLYRLSKQK----Y 457 R W I + DF + L V NG+ IRFW D W + FKD+YPRL+R+ K Y Sbjct: 638 RCPWKAIAQVFQDFSKYTRLVVGNGERIRFWEDLWWGDQIFKDQYPRLFRVVMDKSVPIY 697 Query: 458 ATVANMKSRVWNF 496 + + + + WNF Sbjct: 698 SILGSDRPFSWNF 710 >ref|XP_002466824.1| hypothetical protein SORBIDRAFT_01g014740 [Sorghum bicolor] gi|241920678|gb|EER93822.1| hypothetical protein SORBIDRAFT_01g014740 [Sorghum bicolor] Length = 468 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/53 (47%), Positives = 38/53 (71%) Frame = -1 Query: 233 FLDPYLPGGAVPTRHFKIPKFEFCFNFEAKRILENVGLVLPFDNKKAELTEML 75 FLD Y+P VP FK+PKF+ F FEA ++L+ +GL LPF + +A+L+E++ Sbjct: 339 FLDKYIPMQKVPVGQFKVPKFKISFGFEASKLLKGLGLQLPF-SAQADLSELV 390