BLASTX nr result
ID: Papaver23_contig00034230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00034230 (510 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_194638.1| Ribonuclease H-like protein [Arabidopsis thalia... 57 2e-06 ref|XP_002461669.1| hypothetical protein SORBIDRAFT_02g006163 [S... 55 6e-06 gb|EEC79285.1| hypothetical protein OsI_20087 [Oryza sativa Indi... 55 6e-06 >ref|NP_194638.1| Ribonuclease H-like protein [Arabidopsis thaliana] gi|4972055|emb|CAB43923.1| putative protein [Arabidopsis thaliana] gi|7269807|emb|CAB79667.1| putative protein [Arabidopsis thaliana] gi|67633766|gb|AAY78807.1| putative reverse transcriptase/RNA-dependent DNA polymerase [Arabidopsis thaliana] gi|332660185|gb|AEE85585.1| Ribonuclease H-like protein [Arabidopsis thaliana] Length = 575 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/69 (34%), Positives = 39/69 (56%) Frame = -3 Query: 292 PIYKKLWGTSVMHKVQLFIWKCFENILPSKCKLSQYSSHQDTYCNMCNDNHHETTEHIIL 113 PIY+K+W + K+Q F+WKC N LP L+ +++ C C + ET H++ Sbjct: 252 PIYQKIWKSQTSPKIQHFLWKCLSNSLPVAGALAYRHLSKESACIRC-PSCKETVNHLLF 310 Query: 112 QCSFSRTLW 86 +C+F+R W Sbjct: 311 KCTFARLTW 319 >ref|XP_002461669.1| hypothetical protein SORBIDRAFT_02g006163 [Sorghum bicolor] gi|241925046|gb|EER98190.1| hypothetical protein SORBIDRAFT_02g006163 [Sorghum bicolor] Length = 890 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 1/89 (1%) Frame = -3 Query: 283 KKLWGTSVMHKVQLFIWKCFENILPSKCKLSQYSSHQDTYCNMCNDNHHETTEHIILQCS 104 K+LW T KV+ F W L + + +++ Q C++C ET++H++L C Sbjct: 748 KELWKTKAPPKVKFFFWLALHGRLWTAARRARHRLQQSASCSLCG-QQDETSDHLLLSCV 806 Query: 103 FSRTLW-ESVSHGNLVLPDFGTNITISNW 20 FSR W +S NL P G++ T+ +W Sbjct: 807 FSREAWFRLLSFTNLQQPAPGSDDTLVDW 835 >gb|EEC79285.1| hypothetical protein OsI_20087 [Oryza sativa Indica Group] gi|218196859|gb|EEC79286.1| hypothetical protein OsI_20088 [Oryza sativa Indica Group] Length = 216 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/71 (29%), Positives = 38/71 (53%) Frame = -3 Query: 286 YKKLWGTSVMHKVQLFIWKCFENILPSKCKLSQYSSHQDTYCNMCNDNHHETTEHIILQC 107 ++K+W V +K+++F+W+ N LP +C + + D C MCN E H+ L+C Sbjct: 108 WEKIWNMEVPNKIKMFVWRLAHNSLPVRCNIRRRGMESDNLCPMCN-RFDEDCGHLFLKC 166 Query: 106 SFSRTLWESVS 74 + W S++ Sbjct: 167 KGVKECWRSLN 177