BLASTX nr result
ID: Papaver23_contig00033840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00033840 (605 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53253.1| JHL25P11.1 [Jatropha curcas] 57 2e-06 ref|XP_002521807.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >dbj|BAJ53253.1| JHL25P11.1 [Jatropha curcas] Length = 180 Score = 57.4 bits (137), Expect = 2e-06 Identities = 37/89 (41%), Positives = 49/89 (55%), Gaps = 3/89 (3%) Frame = -1 Query: 494 TRLVFLILCSPFLIPILCFTFPWLCIIHLCCKRFKYTKIDENGLIQEINPTSIPVVDXXX 315 +R +FLILCSP L+P LC FP LC + LC + + + + G +E Sbjct: 65 SRCLFLILCSPILLPFLCAIFPLLCAVELCIRICRRGQRMKEGEDEEERLRRCEEGYCNC 124 Query: 314 XENQGEGR---LLQRYLEDQLDLVVRSLY 237 GEG+ LLQRYLEDQL L+V S+Y Sbjct: 125 DRLVGEGKEVGLLQRYLEDQL-LLVGSMY 152 >ref|XP_002521807.1| conserved hypothetical protein [Ricinus communis] gi|223539020|gb|EEF40617.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 57.0 bits (136), Expect = 3e-06 Identities = 39/98 (39%), Positives = 50/98 (51%), Gaps = 9/98 (9%) Frame = -1 Query: 494 TRLVFLILCSPFLIPILCFTFPWLCIIHLC---CKRFKYTK---IDENGLIQEINPTSIP 333 +R VFL+LCSP L+P LC +FP LC LC C+R + K DE+ + + Sbjct: 62 SRCVFLLLCSPILLPFLCASFPLLCAAELCIRICRRARRRKDGDDDEDDDVDGLRRCEEG 121 Query: 332 VVDXXXXENQGEGR---LLQRYLEDQLDLVVRSLYYDC 228 D E + LLQRYLEDQL LV Y+C Sbjct: 122 FRDCGCSRRAEEEKEVGLLQRYLEDQLRLV--GSVYEC 157