BLASTX nr result
ID: Papaver23_contig00033802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00033802 (817 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308775.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-21 ref|XP_002322538.1| predicted protein [Populus trichocarpa] gi|2... 73 7e-21 emb|CBI33123.3| unnamed protein product [Vitis vinifera] 72 2e-20 ref|XP_002262798.2| PREDICTED: transcription initiation factor I... 72 2e-20 ref|XP_003594206.1| Transcription initiation factor IIF subunit ... 66 3e-18 >ref|XP_002308775.1| predicted protein [Populus trichocarpa] gi|222854751|gb|EEE92298.1| predicted protein [Populus trichocarpa] Length = 541 Score = 72.4 bits (176), Expect(2) = 5e-21 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 116 EKNADNKWALRKEGLVGRQVTDTLREKFKNKPWLLEDE 3 +KNA+NKW+L KEG+ GRQ+TDTLREKFKNKPWLLEDE Sbjct: 86 KKNAENKWSLLKEGIHGRQITDTLREKFKNKPWLLEDE 123 Score = 55.1 bits (131), Expect(2) = 5e-21 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -1 Query: 202 QEYNVRACSTSDKNYFIGRFVSGVPGFSKRK 110 +EYNVRA ++S+KNYFIGRFV+G+PGFSK+K Sbjct: 57 REYNVRASTSSEKNYFIGRFVTGLPGFSKKK 87 >ref|XP_002322538.1| predicted protein [Populus trichocarpa] gi|222867168|gb|EEF04299.1| predicted protein [Populus trichocarpa] Length = 540 Score = 72.8 bits (177), Expect(2) = 7e-21 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 116 EKNADNKWALRKEGLVGRQVTDTLREKFKNKPWLLEDE 3 +KNA+NKW+L KEG++GRQ+TD LREKFKNKPWLLEDE Sbjct: 86 KKNAENKWSLHKEGILGRQITDALREKFKNKPWLLEDE 123 Score = 54.3 bits (129), Expect(2) = 7e-21 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -1 Query: 202 QEYNVRACSTSDKNYFIGRFVSGVPGFSKRK 110 +EYNVRA ++SDKNYFIGRFV+G+P FSK+K Sbjct: 57 REYNVRASTSSDKNYFIGRFVTGLPSFSKKK 87 >emb|CBI33123.3| unnamed protein product [Vitis vinifera] Length = 539 Score = 71.6 bits (174), Expect(2) = 2e-20 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 EKNADNKWALRKEGLVGRQVTDTLREKFKNKPWLLEDE 3 +KNADNKW+L KEGL GRQV+D LREK+KNKPWLLEDE Sbjct: 86 KKNADNKWSLHKEGLQGRQVSDALREKYKNKPWLLEDE 123 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 202 QEYNVRACSTSDKNYFIGRFVSGVPGFSKRK 110 +EYNVR S+ DKNYFIGRFV+G+PGFSK+K Sbjct: 57 REYNVRTNSSGDKNYFIGRFVTGLPGFSKKK 87 >ref|XP_002262798.2| PREDICTED: transcription initiation factor IIF subunit alpha-like [Vitis vinifera] Length = 534 Score = 71.6 bits (174), Expect(2) = 2e-20 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 EKNADNKWALRKEGLVGRQVTDTLREKFKNKPWLLEDE 3 +KNADNKW+L KEGL GRQV+D LREK+KNKPWLLEDE Sbjct: 81 KKNADNKWSLHKEGLQGRQVSDALREKYKNKPWLLEDE 118 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 202 QEYNVRACSTSDKNYFIGRFVSGVPGFSKRK 110 +EYNVR S+ DKNYFIGRFV+G+PGFSK+K Sbjct: 52 REYNVRTNSSGDKNYFIGRFVTGLPGFSKKK 82 >ref|XP_003594206.1| Transcription initiation factor IIF subunit alpha [Medicago truncatula] gi|87241158|gb|ABD33016.1| Transcription Factor IIF, Rap30/Rap74, interaction [Medicago truncatula] gi|355483254|gb|AES64457.1| Transcription initiation factor IIF subunit alpha [Medicago truncatula] Length = 536 Score = 65.9 bits (159), Expect(2) = 3e-18 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -3 Query: 116 EKNADNKWALRKEGLVGRQVTDTLREKFKNKPWLLEDE 3 +K+A+NKW+L+K+GL GRQVTD REK+KN+PWLLEDE Sbjct: 84 KKSAENKWSLQKDGLKGRQVTDATREKYKNRPWLLEDE 121 Score = 52.4 bits (124), Expect(2) = 3e-18 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 202 QEYNVRACSTSDKNYFIGRFVSGVPGFSKRK 110 +EYNVRA S +DKNYFIGRF++G+P FSK+K Sbjct: 55 REYNVRASSANDKNYFIGRFMTGLPDFSKKK 85