BLASTX nr result
ID: Papaver23_contig00033534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00033534 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO86797.1| cyclin [Camellia sinensis] 57 2e-06 >gb|AEO86797.1| cyclin [Camellia sinensis] Length = 439 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +2 Query: 341 SDENNPSLMRPTMFQENLRMGSGKFVAEVGHNRRALSTINRN 466 SDEN P ++RPT Q L G+GK A +GHNRRALSTINRN Sbjct: 4 SDENLPGVIRPTNIQGGLHPGAGKLAAGMGHNRRALSTINRN 45