BLASTX nr result
ID: Papaver23_contig00033016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00033016 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003576727.1| PREDICTED: uncharacterized protein LOC100823... 55 5e-06 ref|XP_002263044.1| PREDICTED: U11/U12 small nuclear ribonucleop... 55 8e-06 >ref|XP_003576727.1| PREDICTED: uncharacterized protein LOC100823301 [Brachypodium distachyon] Length = 416 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +3 Query: 6 IPFDDLKRLGIPPPPEGRYMTLHQVXXXXXXXXNSVDREE 125 IP+D+LK+LGIPPPPEGRYMT ++V +++DREE Sbjct: 182 IPYDELKKLGIPPPPEGRYMTRYEVPPLPRRKGSNIDREE 221 >ref|XP_002263044.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 35 kDa protein [Vitis vinifera] gi|297743756|emb|CBI36639.3| unnamed protein product [Vitis vinifera] Length = 340 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +3 Query: 6 IPFDDLKRLGIPPPPEGRYMTLHQVXXXXXXXXNSVDREE 125 IP DDLKRLGIPPPPEGRYM+ QV +++DREE Sbjct: 179 IPLDDLKRLGIPPPPEGRYMSRFQVPPPPRRKRSNMDREE 218