BLASTX nr result
ID: Papaver23_contig00032945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00032945 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20238.3| unnamed protein product [Vitis vinifera] 79 5e-13 ref|XP_002282857.1| PREDICTED: protein transport protein Sec24-l... 79 5e-13 ref|XP_002533043.1| Protein transport protein Sec24A, putative [... 70 1e-10 ref|XP_003553695.1| PREDICTED: protein transport protein Sec24-l... 69 5e-10 ref|XP_003520784.1| PREDICTED: protein transport protein Sec24-l... 68 7e-10 >emb|CBI20238.3| unnamed protein product [Vitis vinifera] Length = 944 Score = 78.6 bits (192), Expect = 5e-13 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 1 LCEHDNDASKNLMGIIKRFRVASSSSYQLCHLVRQGEQPREGSLLLANLVE 153 L EHDN+ S+ LMGI+K+FR + S YQLCHLVRQGEQPREG LLANLVE Sbjct: 870 LYEHDNEMSRKLMGILKKFRESDPSYYQLCHLVRQGEQPREGFFLLANLVE 920 >ref|XP_002282857.1| PREDICTED: protein transport protein Sec24-like At3g07100-like [Vitis vinifera] Length = 1052 Score = 78.6 bits (192), Expect = 5e-13 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 1 LCEHDNDASKNLMGIIKRFRVASSSSYQLCHLVRQGEQPREGSLLLANLVE 153 L EHDN+ S+ LMGI+K+FR + S YQLCHLVRQGEQPREG LLANLVE Sbjct: 978 LYEHDNEMSRKLMGILKKFRESDPSYYQLCHLVRQGEQPREGFFLLANLVE 1028 >ref|XP_002533043.1| Protein transport protein Sec24A, putative [Ricinus communis] gi|223527181|gb|EEF29351.1| Protein transport protein Sec24A, putative [Ricinus communis] Length = 1031 Score = 70.1 bits (170), Expect(2) = 1e-10 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +1 Query: 1 LCEHDNDASKNLMGIIKRFRVASSSSYQLCHLVRQGEQPREGSLLLANLVE 153 L EHD + S+ LM I+K+ R + S YQLCHLVRQGEQPREG LLL NLVE Sbjct: 957 LREHDTEMSRKLMEILKKLRESDHSYYQLCHLVRQGEQPREGFLLLMNLVE 1007 Score = 20.8 bits (42), Expect(2) = 1e-10 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 Query: 249 GANGYVEW 272 G NGYV+W Sbjct: 1012 GTNGYVDW 1019 >ref|XP_003553695.1| PREDICTED: protein transport protein Sec24-like At3g07100-like [Glycine max] Length = 1026 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/51 (60%), Positives = 40/51 (78%) Frame = +1 Query: 1 LCEHDNDASKNLMGIIKRFRVASSSSYQLCHLVRQGEQPREGSLLLANLVE 153 L EHDN+ S+ L+ ++++ R + YQLCHLVRQGEQP+EG LLLANLVE Sbjct: 953 LSEHDNEMSRRLVKVLEKLRNTDRAYYQLCHLVRQGEQPKEGFLLLANLVE 1003 >ref|XP_003520784.1| PREDICTED: protein transport protein Sec24-like At3g07100-like [Glycine max] Length = 1028 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = +1 Query: 1 LCEHDNDASKNLMGIIKRFRVASSSSYQLCHLVRQGEQPREGSLLLANLVE 153 L EHDN+ S+ L+ ++++ R + YQLCHLVRQGEQP+EG LLL+NLVE Sbjct: 955 LSEHDNEMSRRLVKVLEKLRYTDRAYYQLCHLVRQGEQPKEGFLLLSNLVE 1005