BLASTX nr result
ID: Papaver23_contig00032672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00032672 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP55584.1| GTPase-activating protein [Rosa rugosa] 112 2e-23 ref|XP_002518219.1| conserved hypothetical protein [Ricinus comm... 110 9e-23 ref|XP_002317818.1| predicted protein [Populus trichocarpa] gi|2... 109 3e-22 ref|XP_002518218.1| conserved hypothetical protein [Ricinus comm... 108 4e-22 ref|XP_002518905.1| conserved hypothetical protein [Ricinus comm... 108 4e-22 >gb|AFP55584.1| GTPase-activating protein [Rosa rugosa] Length = 589 Score = 112 bits (281), Expect = 2e-23 Identities = 54/63 (85%), Positives = 57/63 (90%), Gaps = 1/63 (1%) Frame = -1 Query: 475 HLEPCRVFHAARLVATLEAYAFYDDEIGYFQGITDLLSPIAA-MVEDYEAFWCFVGFMKK 299 HLEPCRVFHAARLVA LEAYA YD EIGY QG++DLLSPIAA M ED+EAFWCFVGFMKK Sbjct: 365 HLEPCRVFHAARLVAILEAYALYDPEIGYCQGMSDLLSPIAAVMTEDHEAFWCFVGFMKK 424 Query: 298 ARH 290 ARH Sbjct: 425 ARH 427 >ref|XP_002518219.1| conserved hypothetical protein [Ricinus communis] gi|223542624|gb|EEF44162.1| conserved hypothetical protein [Ricinus communis] Length = 544 Score = 110 bits (276), Expect = 9e-23 Identities = 52/63 (82%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = -1 Query: 475 HLEPCRVFHAARLVATLEAYAFYDDEIGYFQGITDLLSP-IAAMVEDYEAFWCFVGFMKK 299 HLEPCR+FHAARLVA LEAYA YD EIGY QG++DLLSP IA M ED+EAFWCFVGFMKK Sbjct: 326 HLEPCRIFHAARLVAILEAYALYDPEIGYCQGMSDLLSPIIAVMTEDHEAFWCFVGFMKK 385 Query: 298 ARH 290 ARH Sbjct: 386 ARH 388 >ref|XP_002317818.1| predicted protein [Populus trichocarpa] gi|222858491|gb|EEE96038.1| predicted protein [Populus trichocarpa] Length = 431 Score = 109 bits (272), Expect = 3e-22 Identities = 52/63 (82%), Positives = 57/63 (90%), Gaps = 1/63 (1%) Frame = -1 Query: 475 HLEPCRVFHAARLVATLEAYAFYDDEIGYFQGITDLLSPIAAMV-EDYEAFWCFVGFMKK 299 HLEPCRVFHAARLVA LEAYA YD EIGY QG++DLLSPI A+V ED+EAFWCFVGFM+K Sbjct: 213 HLEPCRVFHAARLVAILEAYAVYDPEIGYCQGMSDLLSPIIAVVTEDHEAFWCFVGFMRK 272 Query: 298 ARH 290 ARH Sbjct: 273 ARH 275 >ref|XP_002518218.1| conserved hypothetical protein [Ricinus communis] gi|223542623|gb|EEF44161.1| conserved hypothetical protein [Ricinus communis] Length = 547 Score = 108 bits (270), Expect = 4e-22 Identities = 50/63 (79%), Positives = 56/63 (88%), Gaps = 1/63 (1%) Frame = -1 Query: 475 HLEPCRVFHAARLVATLEAYAFYDDEIGYFQGITDLLSPIAAMV-EDYEAFWCFVGFMKK 299 HLEPCR+FHAARLVA LEAYA YD EIGY QG++DLLSPI ++ ED+EAFWCFVGFMKK Sbjct: 329 HLEPCRIFHAARLVAILEAYALYDPEIGYCQGMSDLLSPIITVITEDHEAFWCFVGFMKK 388 Query: 298 ARH 290 ARH Sbjct: 389 ARH 391 >ref|XP_002518905.1| conserved hypothetical protein [Ricinus communis] gi|223541892|gb|EEF43438.1| conserved hypothetical protein [Ricinus communis] Length = 554 Score = 108 bits (270), Expect = 4e-22 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 1/63 (1%) Frame = -1 Query: 475 HLEPCRVFHAARLVATLEAYAFYDDEIGYFQGITDLLSPIAAMV-EDYEAFWCFVGFMKK 299 HLEPCR+FHAARLVA LEAYA YD E GY QG++DLLSPI ++ EDYEAFWCFVGFMKK Sbjct: 340 HLEPCRIFHAARLVAILEAYALYDPETGYCQGMSDLLSPIIVVIEEDYEAFWCFVGFMKK 399 Query: 298 ARH 290 ARH Sbjct: 400 ARH 402