BLASTX nr result
ID: Papaver23_contig00032240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00032240 (534 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513482.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002513482.1| conserved hypothetical protein [Ricinus communis] gi|223547390|gb|EEF48885.1| conserved hypothetical protein [Ricinus communis] Length = 152 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/67 (34%), Positives = 37/67 (55%) Frame = -2 Query: 209 WLRLWHMDTLPKFRLFIWNCFQNILPFKMYMLKLRVVASDLCPICSLRPESFEHLFFYGD 30 W+ +W + PK R F+W C N L K+ ++ + LC C ++ E+ EHL F+ D Sbjct: 77 WISIWQLKVPPKVRAFMWKCAHNALAIKINLVHKHCGNNGLCSNCGMQEEALEHLMFFCD 136 Query: 29 FARII*F 9 A++I F Sbjct: 137 RAKLIWF 143