BLASTX nr result
ID: Papaver23_contig00032033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00032033 (1201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002995203.1| transcription regulator, encoded next to Rec... 57 7e-06 >ref|YP_002995203.1| transcription regulator, encoded next to RecA superfamily ATPas [Thermococcus sibiricus MM 739] gi|242266172|gb|ACS90854.1| Predicted transcription regulator, encoded next to RecA superfamily ATPas [Thermococcus sibiricus MM 739] Length = 319 Score = 57.4 bits (137), Expect = 7e-06 Identities = 40/144 (27%), Positives = 73/144 (50%), Gaps = 2/144 (1%) Frame = +1 Query: 415 REVHYIENGGLAAVESSPKEKELTAKLTATVAERDQERKKNTSLQKQLNTEMAERQILEG 594 + + IE GGL V + + ++L + E ++ + + +++ ++ E E+ I G Sbjct: 113 KTIEMIEKGGLKEVIAKEEYEKLMQEYENLKLEYEKVKAELEKMKQTVDLESLEKAI--G 170 Query: 595 LLKKANSEIEQERAERRSLEEKNSSLQKDLLNEVSQ--ERAERRILEDTNSKLTEGLKTE 768 +++ E+E +AE ++N L+K+L + E +RI E +L E LK + Sbjct: 171 KIERLRKELEAVKAELEKTRKENKELKKELAEARVKIMELQSKRIEETKVKELEEKLKAK 230 Query: 769 GGERQTLERLLEKVNAEKAELENK 840 E LERL+++V EK ELE K Sbjct: 231 EEELSRLERLVDEVTREKLELEKK 254