BLASTX nr result
ID: Papaver23_contig00031688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00031688 (640 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24184.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_002524572.1| hypothetical protein RCOM_1211540 [Ricinus c... 60 4e-07 ref|XP_002321223.1| predicted protein [Populus trichocarpa] gi|2... 56 5e-06 >emb|CBI24184.3| unnamed protein product [Vitis vinifera] Length = 1188 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/57 (57%), Positives = 42/57 (73%), Gaps = 4/57 (7%) Frame = -3 Query: 308 QDNGINNHN----RRKTPFQLESLENFYSEEPFPTQETLEDYAFVLNLTYKQVRGWF 150 +D+G N N RRKTP QL++LE+ YSE+ +PTQ ++DYA L LTYKQVRGWF Sbjct: 10 EDHGTINTNTNSIRRKTPLQLKTLESLYSEDNYPTQRVMKDYAAALGLTYKQVRGWF 66 >ref|XP_002524572.1| hypothetical protein RCOM_1211540 [Ricinus communis] gi|223536125|gb|EEF37780.1| hypothetical protein RCOM_1211540 [Ricinus communis] Length = 1120 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/44 (54%), Positives = 37/44 (84%) Frame = -3 Query: 281 RRKTPFQLESLENFYSEEPFPTQETLEDYAFVLNLTYKQVRGWF 150 +RK+P QL++LE FY+E+ +P+Q +E+ A VL+LT+KQV+GWF Sbjct: 4 KRKSPLQLQALEKFYAEQKYPSQMVMEELAGVLDLTFKQVQGWF 47 >ref|XP_002321223.1| predicted protein [Populus trichocarpa] gi|222861996|gb|EEE99538.1| predicted protein [Populus trichocarpa] Length = 1152 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/45 (55%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -3 Query: 281 RRKTPFQLESLENFYS-EEPFPTQETLEDYAFVLNLTYKQVRGWF 150 +RK+P QL++L FY+ E+ +P+Q +ED A V NLT+KQVRGWF Sbjct: 2 KRKSPLQLQALLKFYAAEDKYPSQRAMEDLAVVSNLTFKQVRGWF 46