BLASTX nr result
ID: Papaver23_contig00031669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00031669 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25132.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002271957.1| PREDICTED: ribosomal RNA small subunit methy... 64 2e-08 emb|CAN83371.1| hypothetical protein VITISV_034944 [Vitis vinifera] 64 2e-08 ref|XP_002300283.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_003555302.1| PREDICTED: ribosomal RNA small subunit methy... 61 1e-07 >emb|CBI25132.3| unnamed protein product [Vitis vinifera] Length = 410 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 6 MMTEAGAIPVGLGPHRLRVETATMALPTTVMLWSDSQHP 122 MM EAGA VGLGPHRLRVETAT+AL T+MLWSDS+ P Sbjct: 369 MMREAGATAVGLGPHRLRVETATIALLATLMLWSDSERP 407 >ref|XP_002271957.1| PREDICTED: ribosomal RNA small subunit methyltransferase E-like [Vitis vinifera] Length = 287 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 6 MMTEAGAIPVGLGPHRLRVETATMALPTTVMLWSDSQHP 122 MM EAGA VGLGPHRLRVETAT+AL T+MLWSDS+ P Sbjct: 246 MMREAGATAVGLGPHRLRVETATIALLATLMLWSDSERP 284 >emb|CAN83371.1| hypothetical protein VITISV_034944 [Vitis vinifera] Length = 259 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 6 MMTEAGAIPVGLGPHRLRVETATMALPTTVMLWSDSQHP 122 MM EAGA VGLGPHRLRVETAT+AL T+MLWSDS+ P Sbjct: 218 MMREAGATAVGLGPHRLRVETATIALLATLMLWSDSERP 256 >ref|XP_002300283.1| predicted protein [Populus trichocarpa] gi|222847541|gb|EEE85088.1| predicted protein [Populus trichocarpa] Length = 212 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 6 MMTEAGAIPVGLGPHRLRVETATMALPTTVMLWSDSQ 116 MM +AGA VGLGPHRLRVETATMAL T+MLWSDSQ Sbjct: 176 MMMKAGASAVGLGPHRLRVETATMALLATLMLWSDSQ 212 >ref|XP_003555302.1| PREDICTED: ribosomal RNA small subunit methyltransferase E-like [Glycine max] Length = 281 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +3 Query: 6 MMTEAGAIPVGLGPHRLRVETATMALPTTVMLWSDSQ 116 MM EAGA V LGPHRLRVETAT+AL TVMLWSDSQ Sbjct: 222 MMMEAGATAVSLGPHRLRVETATIALLATVMLWSDSQ 258