BLASTX nr result
ID: Papaver23_contig00031634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00031634 (1224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 48 6e-08 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 48.1 bits (113), Expect(2) = 6e-08 Identities = 25/70 (35%), Positives = 40/70 (57%) Frame = +1 Query: 349 FQSHSNSHNVGHTYTKIPKLDIPRFGGEILRR*IQKYYRYS*IHPVADEQKIEFGSLHLD 528 F SN +G+ IPKL P+F G LR+ I+K +Y + D+QK++ SL++ Sbjct: 20 FDERSNQPRLGY----IPKLKFPKFDGSNLRQWIKKCCKYFVFCKIPDKQKVDLASLNMV 75 Query: 529 VKADSWLFGY 558 KA++W+ Y Sbjct: 76 DKAENWVSSY 85 Score = 36.2 bits (82), Expect(2) = 6e-08 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%) Frame = +3 Query: 570 TSLPWYAFVDSICSRFEDLANDNYAGCFNKLSQLTSVDVY---FE*FKALILSKNPHLIE 740 T++ W FV + SRF+D + N FNKL Q S++ Y FE K+ +L + L E Sbjct: 90 TAVDWNDFVIDVNSRFKDESGINVVEEFNKLQQTNSLEDYIDEFEKVKSSMLQNSYVLPE 149 Query: 741 E*FVLSFI 764 + + SF+ Sbjct: 150 KHLMESFV 157