BLASTX nr result
ID: Papaver23_contig00031598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00031598 (529 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511505.1| pentatricopeptide repeat-containing protein,... 145 5e-33 ref|XP_004154991.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 141 5e-32 ref|XP_004138146.1| PREDICTED: pentatricopeptide repeat-containi... 141 5e-32 ref|XP_003527053.1| PREDICTED: pentatricopeptide repeat-containi... 140 9e-32 ref|XP_002321537.1| predicted protein [Populus trichocarpa] gi|2... 139 3e-31 >ref|XP_002511505.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550620|gb|EEF52107.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 876 Score = 145 bits (365), Expect = 5e-33 Identities = 67/88 (76%), Positives = 77/88 (87%) Frame = +3 Query: 3 AITALSRTLAWFRKKMIASGIGPSRIDIVTGWGRRSRVTGSSLVRESVHELLDMFQFPFL 182 A+TALSRTLAWFR++M+ SGI PSRIDIVTGWGRRSRVTGSS+VR++V ELL +F FPF Sbjct: 786 AVTALSRTLAWFRQQMLVSGISPSRIDIVTGWGRRSRVTGSSMVRQAVQELLHIFSFPFF 845 Query: 183 PENGNSGCFVGSGDSLNRWLYQPCVERM 266 ENGNSGCFVG G+ LNRWL QP V+RM Sbjct: 846 TENGNSGCFVGCGEPLNRWLLQPYVDRM 873 >ref|XP_004154991.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g18900-like [Cucumis sativus] Length = 874 Score = 141 bits (356), Expect = 5e-32 Identities = 64/88 (72%), Positives = 78/88 (88%) Frame = +3 Query: 3 AITALSRTLAWFRKKMIASGIGPSRIDIVTGWGRRSRVTGSSLVRESVHELLDMFQFPFL 182 A+TALSRTLAWFR++++ SG+GPSRIDIVTGWGRRS+VTGSSLVR++V +LL +F FPF Sbjct: 784 AVTALSRTLAWFRQQLLLSGVGPSRIDIVTGWGRRSKVTGSSLVRQAVQDLLSIFSFPFF 843 Query: 183 PENGNSGCFVGSGDSLNRWLYQPCVERM 266 ENGNSGCFVG G+ L+RWL+Q VERM Sbjct: 844 TENGNSGCFVGCGEPLSRWLHQSYVERM 871 >ref|XP_004138146.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Cucumis sativus] Length = 874 Score = 141 bits (356), Expect = 5e-32 Identities = 64/88 (72%), Positives = 78/88 (88%) Frame = +3 Query: 3 AITALSRTLAWFRKKMIASGIGPSRIDIVTGWGRRSRVTGSSLVRESVHELLDMFQFPFL 182 A+TALSRTLAWFR++++ SG+GPSRIDIVTGWGRRS+VTGSSLVR++V +LL +F FPF Sbjct: 784 AVTALSRTLAWFRQQLLLSGVGPSRIDIVTGWGRRSKVTGSSLVRQAVQDLLSIFSFPFF 843 Query: 183 PENGNSGCFVGSGDSLNRWLYQPCVERM 266 ENGNSGCFVG G+ L+RWL+Q VERM Sbjct: 844 TENGNSGCFVGCGEPLSRWLHQSYVERM 871 >ref|XP_003527053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18900-like [Glycine max] Length = 882 Score = 140 bits (354), Expect = 9e-32 Identities = 64/88 (72%), Positives = 77/88 (87%) Frame = +3 Query: 3 AITALSRTLAWFRKKMIASGIGPSRIDIVTGWGRRSRVTGSSLVRESVHELLDMFQFPFL 182 A+TALSRTLAWFR++M+ASG+GP+RIDI+TGWGRRSRVTGSSLVR++V ELL +F FPF Sbjct: 792 AVTALSRTLAWFRRQMLASGVGPNRIDIITGWGRRSRVTGSSLVRQAVQELLHVFSFPFF 851 Query: 183 PENGNSGCFVGSGDSLNRWLYQPCVERM 266 ENGNSGCFVG G+ L++WL VERM Sbjct: 852 TENGNSGCFVGCGEPLSQWLVHSYVERM 879 >ref|XP_002321537.1| predicted protein [Populus trichocarpa] gi|222868533|gb|EEF05664.1| predicted protein [Populus trichocarpa] Length = 834 Score = 139 bits (350), Expect = 3e-31 Identities = 65/88 (73%), Positives = 76/88 (86%) Frame = +3 Query: 3 AITALSRTLAWFRKKMIASGIGPSRIDIVTGWGRRSRVTGSSLVRESVHELLDMFQFPFL 182 A+TALSRTLAWFR++M+ SG+ PSRIDIVTGWGRRSRVTGSSLVR++V ELL +F FPF Sbjct: 744 AVTALSRTLAWFRRQMLVSGVIPSRIDIVTGWGRRSRVTGSSLVRQAVQELLHIFSFPFF 803 Query: 183 PENGNSGCFVGSGDSLNRWLYQPCVERM 266 ENGN+GCFVG G+ L+RWL Q VERM Sbjct: 804 TENGNTGCFVGCGEPLSRWLLQSYVERM 831