BLASTX nr result
ID: Papaver23_contig00031536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00031536 (763 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532866.1| conserved hypothetical protein [Ricinus comm... 69 1e-09 emb|CBI18046.3| unnamed protein product [Vitis vinifera] 68 2e-09 ref|XP_002267193.1| PREDICTED: uncharacterized protein LOC100260... 68 2e-09 ref|XP_004168924.1| PREDICTED: MACPF domain-containing protein C... 67 4e-09 ref|XP_004142683.1| PREDICTED: MACPF domain-containing protein C... 67 4e-09 >ref|XP_002532866.1| conserved hypothetical protein [Ricinus communis] gi|223527378|gb|EEF29520.1| conserved hypothetical protein [Ricinus communis] Length = 563 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 109 NAAALHTIVNSVQALGKGFDVNFDTRLLYCKGVAGS 2 NAAA+HT +NSVQALG+GFDVNFDTRLLYCKGV GS Sbjct: 12 NAAAMHTAMNSVQALGRGFDVNFDTRLLYCKGVTGS 47 >emb|CBI18046.3| unnamed protein product [Vitis vinifera] Length = 623 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -1 Query: 118 MEENAAALHTIVNSVQALGKGFDVNFDTRLLYCKGVAGS 2 M E A ALHT +NSVQALG+GFDVNFDTRLLYCKG AGS Sbjct: 41 MGEKAVALHTALNSVQALGRGFDVNFDTRLLYCKGGAGS 79 >ref|XP_002267193.1| PREDICTED: uncharacterized protein LOC100260206 [Vitis vinifera] Length = 615 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -1 Query: 118 MEENAAALHTIVNSVQALGKGFDVNFDTRLLYCKGVAGS 2 M E A ALHT +NSVQALG+GFDVNFDTRLLYCKG AGS Sbjct: 59 MGEKAVALHTALNSVQALGRGFDVNFDTRLLYCKGGAGS 97 >ref|XP_004168924.1| PREDICTED: MACPF domain-containing protein CAD1-like [Cucumis sativus] Length = 560 Score = 67.0 bits (162), Expect = 4e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 118 MEENAAALHTIVNSVQALGKGFDVNFDTRLLYCKGVAGS 2 M E+ ALHT N+VQALG+GFDVNFDTRLLYCKGVAGS Sbjct: 1 MGESGTALHTASNAVQALGRGFDVNFDTRLLYCKGVAGS 39 >ref|XP_004142683.1| PREDICTED: MACPF domain-containing protein CAD1-like [Cucumis sativus] Length = 560 Score = 67.0 bits (162), Expect = 4e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 118 MEENAAALHTIVNSVQALGKGFDVNFDTRLLYCKGVAGS 2 M E+ ALHT N+VQALG+GFDVNFDTRLLYCKGVAGS Sbjct: 1 MGESGTALHTASNAVQALGRGFDVNFDTRLLYCKGVAGS 39