BLASTX nr result
ID: Papaver23_contig00031458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00031458 (691 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003667492.1| hypothetical protein NDAI_0A00910 [Naumovozy... 58 2e-06 ref|XP_001646858.1| hypothetical protein Kpol_2002p71 [Vanderwal... 57 3e-06 ref|XP_451300.1| hypothetical protein [Kluyveromyces lactis NRRL... 57 3e-06 ref|XP_003675288.1| hypothetical protein NCAS_0B08330 [Naumovozy... 57 3e-06 ref|XP_003594327.1| Farnesyl pyrophosphate synthase [Medicago tr... 57 5e-06 >ref|XP_003667492.1| hypothetical protein NDAI_0A00910 [Naumovozyma dairenensis CBS 421] gi|343766258|emb|CCD22249.1| hypothetical protein NDAI_0A00910 [Naumovozyma dairenensis CBS 421] Length = 351 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/57 (54%), Positives = 36/57 (63%) Frame = +1 Query: 466 LRCYASIAFIASSEYGRARNLNSFID*YLQLQAYFLVLDDMMDNSYTWRGQPCWYRV 636 L+ Y S + +A EY + L I+ LQAYFLV DDMMD S T RGQPCWYRV Sbjct: 64 LKGYKSFSDMAKEEYKKVAILGWCIE---LLQAYFLVADDMMDKSITRRGQPCWYRV 117 >ref|XP_001646858.1| hypothetical protein Kpol_2002p71 [Vanderwaltozyma polyspora DSM 70294] gi|156117539|gb|EDO19000.1| hypothetical protein Kpol_2002p71 [Vanderwaltozyma polyspora DSM 70294] Length = 352 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/57 (52%), Positives = 36/57 (63%) Frame = +1 Query: 466 LRCYASIAFIASSEYGRARNLNSFID*YLQLQAYFLVLDDMMDNSYTWRGQPCWYRV 636 L+ Y S+ ++ EY R L ++ LQAYFLV DDMMD S T RGQPCWYRV Sbjct: 65 LKGYNSVDDLSKDEYRRVAVLGWCVE---LLQAYFLVADDMMDKSITRRGQPCWYRV 118 >ref|XP_451300.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140] gi|1346032|sp|P49349.1|FPPS_KLULA RecName: Full=Farnesyl pyrophosphate synthase; Short=FPP synthase; Short=FPS; AltName: Full=(2E,6E)-farnesyl diphosphate synthase; AltName: Full=Dimethylallyltranstransferase; AltName: Full=Farnesyl diphosphate synthase; AltName: Full=Geranyltranstransferase gi|453166|emb|CAA53614.1| Farnesyldiphosphatesynthetase [Kluyveromyces lactis] gi|49640431|emb|CAH02888.1| KLLA0A06732p [Kluyveromyces lactis] gi|1092509|prf||2024223A farnesyl diphosphate synthase Length = 349 Score = 57.4 bits (137), Expect = 3e-06 Identities = 29/57 (50%), Positives = 38/57 (66%) Frame = +1 Query: 466 LRCYASIAFIASSEYGRARNLNSFID*YLQLQAYFLVLDDMMDNSYTWRGQPCWYRV 636 L+ Y S++ +++ EY + L I+ LQAYFLV DDMMD S T RGQPCWY+V Sbjct: 62 LKGYKSVSELSAEEYKKVAILGWCIE---LLQAYFLVADDMMDQSITRRGQPCWYKV 115 >ref|XP_003675288.1| hypothetical protein NCAS_0B08330 [Naumovozyma castellii CBS 4309] gi|342301152|emb|CCC68917.1| hypothetical protein NCAS_0B08330 [Naumovozyma castellii CBS 4309] Length = 351 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/57 (50%), Positives = 37/57 (64%) Frame = +1 Query: 466 LRCYASIAFIASSEYGRARNLNSFID*YLQLQAYFLVLDDMMDNSYTWRGQPCWYRV 636 L+ Y S++ ++ EY + L I+ LQAYFLV DDMMD S T RGQPCWY+V Sbjct: 64 LKGYKSVSELSQEEYKKVALLGWCIE---LLQAYFLVADDMMDKSITRRGQPCWYKV 117 >ref|XP_003594327.1| Farnesyl pyrophosphate synthase [Medicago truncatula] gi|355483375|gb|AES64578.1| Farnesyl pyrophosphate synthase [Medicago truncatula] gi|388513515|gb|AFK44819.1| unknown [Medicago truncatula] Length = 342 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 556 LQAYFLVLDDMMDNSYTWRGQPCWYRV 636 LQAYFLVLDD+MDNS+T RGQPCWYRV Sbjct: 85 LQAYFLVLDDIMDNSHTRRGQPCWYRV 111