BLASTX nr result
ID: Papaver23_contig00029625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00029625 (692 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149759.1| PREDICTED: translation initiation factor IF-... 68 5e-12 ref|XP_003566671.1| PREDICTED: translation initiation factor IF-... 66 8e-12 ref|XP_003613053.1| Translation initiation factor IF-2 [Medicago... 65 3e-11 ref|XP_002446541.1| hypothetical protein SORBIDRAFT_06g017820 [S... 66 6e-11 tpg|DAA37623.1| TPA: putative translation elongation/initiation ... 67 8e-11 >ref|XP_004149759.1| PREDICTED: translation initiation factor IF-2-like [Cucumis sativus] Length = 724 Score = 68.2 bits (165), Expect(2) = 5e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 112 TVAAREAGCITQHLGAFIVEMQSGASITFLDTPGHAA 2 +VAAREAG ITQHLGAF+VEM SGASITFLDTPGHAA Sbjct: 229 SVAAREAGGITQHLGAFVVEMASGASITFLDTPGHAA 265 Score = 28.5 bits (62), Expect(2) = 5e-12 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -1 Query: 158 SSIVAMEVGVNVKRRHCGCEGS 93 + +VAMEVGVN+KR H EGS Sbjct: 179 AELVAMEVGVNIKRLH-SSEGS 199 >ref|XP_003566671.1| PREDICTED: translation initiation factor IF-2-like [Brachypodium distachyon] Length = 711 Score = 66.2 bits (160), Expect(2) = 8e-12 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 112 TVAAREAGCITQHLGAFIVEMQSGASITFLDTPGHAA 2 +VAA+EAG ITQH+GAF+VEM SGASITFLDTPGHAA Sbjct: 216 SVAAKEAGGITQHIGAFVVEMTSGASITFLDTPGHAA 252 Score = 29.6 bits (65), Expect(2) = 8e-12 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 158 SSIVAMEVGVNVKRRHCG 105 + +VAME+GVN+KR H G Sbjct: 167 AELVAMEIGVNIKRMHTG 184 >ref|XP_003613053.1| Translation initiation factor IF-2 [Medicago truncatula] gi|355514388|gb|AES96011.1| Translation initiation factor IF-2 [Medicago truncatula] Length = 749 Score = 64.7 bits (156), Expect(2) = 3e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 112 TVAAREAGCITQHLGAFIVEMQSGASITFLDTPGHAA 2 +VAA+EAG ITQHLGAF+V M SGASITFLDTPGHAA Sbjct: 177 SVAAKEAGGITQHLGAFVVGMSSGASITFLDTPGHAA 213 Score = 29.3 bits (64), Expect(2) = 3e-11 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 158 SSIVAMEVGVNVKRRH 111 S +VAMEVGVNVKR H Sbjct: 127 SELVAMEVGVNVKRLH 142 >ref|XP_002446541.1| hypothetical protein SORBIDRAFT_06g017820 [Sorghum bicolor] gi|241937724|gb|EES10869.1| hypothetical protein SORBIDRAFT_06g017820 [Sorghum bicolor] Length = 685 Score = 66.2 bits (160), Expect(2) = 6e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 112 TVAAREAGCITQHLGAFIVEMQSGASITFLDTPGHAA 2 +VAA+EAG ITQH+GAF+VEM SGASITFLDTPGHAA Sbjct: 190 SVAAKEAGGITQHIGAFVVEMPSGASITFLDTPGHAA 226 Score = 26.6 bits (57), Expect(2) = 6e-11 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 158 SSIVAMEVGVNVKRRHCG 105 + +VAME+GVN +R H G Sbjct: 141 AELVAMELGVNTRRMHTG 158 >tpg|DAA37623.1| TPA: putative translation elongation/initiation factor family protein [Zea mays] Length = 712 Score = 66.6 bits (161), Expect(2) = 8e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 112 TVAAREAGCITQHLGAFIVEMQSGASITFLDTPGHAA 2 +VAA+EAG ITQH+GAF+VEM SGASITFLDTPGHAA Sbjct: 217 SVAAKEAGGITQHIGAFVVEMSSGASITFLDTPGHAA 253 Score = 25.8 bits (55), Expect(2) = 8e-11 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 158 SSIVAMEVGVNVKRRHCG 105 + +VAME+GVN +R H G Sbjct: 168 AELVAMELGVNSRRMHTG 185