BLASTX nr result
ID: Papaver23_contig00028323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00028323 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263684.2| PREDICTED: uncharacterized sodium-dependent ... 75 8e-12 emb|CAN79649.1| hypothetical protein VITISV_010852 [Vitis vinifera] 75 8e-12 ref|XP_002320573.1| bile acid:Na+ symporter family protein [Popu... 73 3e-11 ref|XP_002527259.1| sodium-bile acid cotransporter, putative [Ri... 72 4e-11 ref|XP_004150363.1| PREDICTED: probable sodium/metabolite cotran... 62 4e-08 >ref|XP_002263684.2| PREDICTED: uncharacterized sodium-dependent transporter yocS-like [Vitis vinifera] gi|297742832|emb|CBI35586.3| unnamed protein product [Vitis vinifera] Length = 411 Score = 74.7 bits (182), Expect = 8e-12 Identities = 36/42 (85%), Positives = 36/42 (85%) Frame = +1 Query: 1 PPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGSTVE 126 PPACSVV MAIMGL LASFWGN RIRDLP L LPQTGSTVE Sbjct: 368 PPACSVVAMAIMGLSLASFWGNGGRIRDLPSLLLPQTGSTVE 409 >emb|CAN79649.1| hypothetical protein VITISV_010852 [Vitis vinifera] Length = 231 Score = 74.7 bits (182), Expect = 8e-12 Identities = 36/42 (85%), Positives = 36/42 (85%) Frame = +1 Query: 1 PPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGSTVE 126 PPACSVV MAIMGL LASFWGN RIRDLP L LPQTGSTVE Sbjct: 188 PPACSVVAMAIMGLSLASFWGNGGRIRDLPSLLLPQTGSTVE 229 >ref|XP_002320573.1| bile acid:Na+ symporter family protein [Populus trichocarpa] gi|222861346|gb|EEE98888.1| bile acid:Na+ symporter family protein [Populus trichocarpa] Length = 417 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +1 Query: 1 PPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGSTVE 126 PPACSVV MAIMGLCLASFWGN YRIRD+P +PQ GS V+ Sbjct: 375 PPACSVVAMAIMGLCLASFWGNGYRIRDIPSYLIPQFGSAVK 416 >ref|XP_002527259.1| sodium-bile acid cotransporter, putative [Ricinus communis] gi|223533352|gb|EEF35103.1| sodium-bile acid cotransporter, putative [Ricinus communis] Length = 356 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = +1 Query: 1 PPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGSTVE 126 PPACSVV MAIMGL LASFWGN YRIRDLP L PQ GSTV+ Sbjct: 314 PPACSVVAMAIMGLSLASFWGNGYRIRDLPSLLTPQFGSTVK 355 >ref|XP_004150363.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like [Cucumis sativus] Length = 433 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 1 PPACSVVTMAIMGLCLASFWGNDYRIRDLPRLFLPQTGS 117 PPACSVV MAIMGLCLASFWG+ +IRDLP L + +T S Sbjct: 391 PPACSVVVMAIMGLCLASFWGSGSKIRDLPSLLVQKTSS 429