BLASTX nr result
ID: Papaver23_contig00027370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00027370 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25382.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|XP_002274437.1| PREDICTED: mini-chromosome maintenance compl... 55 6e-06 >emb|CBI25382.3| unnamed protein product [Vitis vinifera] Length = 588 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/42 (54%), Positives = 37/42 (88%) Frame = +2 Query: 119 ILQRVPYVIRGIRESLVGHLTAVLGNDGVASQSVLLHLLSQI 244 +++ P++++ IRES++GHLTAVLGNDG+A+ +LLHLLS++ Sbjct: 299 VMEVKPHLVKQIRESVLGHLTAVLGNDGLAAHFMLLHLLSRV 340 >ref|XP_002274437.1| PREDICTED: mini-chromosome maintenance complex-binding protein [Vitis vinifera] Length = 596 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/42 (54%), Positives = 37/42 (88%) Frame = +2 Query: 119 ILQRVPYVIRGIRESLVGHLTAVLGNDGVASQSVLLHLLSQI 244 +++ P++++ IRES++GHLTAVLGNDG+A+ +LLHLLS++ Sbjct: 307 VMEVKPHLVKQIRESVLGHLTAVLGNDGLAAHFMLLHLLSRV 348