BLASTX nr result
ID: Papaver23_contig00026518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00026518 (518 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554465.1| PREDICTED: BTB/POZ domain-containing protein... 139 2e-31 ref|XP_003521497.1| PREDICTED: BTB/POZ domain-containing protein... 138 4e-31 gb|ACU24099.1| unknown [Glycine max] 138 4e-31 ref|XP_002264844.2| PREDICTED: BTB/POZ domain-containing protein... 137 7e-31 emb|CAN63084.1| hypothetical protein VITISV_015359 [Vitis vinifera] 137 7e-31 >ref|XP_003554465.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Glycine max] Length = 440 Score = 139 bits (351), Expect = 2e-31 Identities = 65/100 (65%), Positives = 82/100 (82%) Frame = -3 Query: 516 LWLPFVRLSKPLISSWRVDVEGSPPFKVDNEIWQSLESSLVSMVLALPSGDQAEILTQWL 337 +WLPFVR++KPLI S ++ E + K+D E+WQSLES+ VS++LALPSGDQAE+LT+WL Sbjct: 340 VWLPFVRVTKPLIDSVTMNCENAMLLKLDGEMWQSLESTFVSIILALPSGDQAEVLTEWL 399 Query: 336 GTHHTQYPDLTEAFEVWCYRSKVAKRRLTLLGKMRSMSNS 217 + QYPDLTEAFEVWCYRSKVAKRRL+LL +M+NS Sbjct: 400 DNEYMQYPDLTEAFEVWCYRSKVAKRRLSLLEDEHAMTNS 439 >ref|XP_003521497.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Glycine max] Length = 440 Score = 138 bits (348), Expect = 4e-31 Identities = 64/100 (64%), Positives = 82/100 (82%) Frame = -3 Query: 516 LWLPFVRLSKPLISSWRVDVEGSPPFKVDNEIWQSLESSLVSMVLALPSGDQAEILTQWL 337 +WLPFVR++KPLI S ++ E + K+D E+WQSLES+ VS++LALPSGDQAE+LT+WL Sbjct: 340 VWLPFVRVTKPLIDSVTMNCENAMLLKLDGEMWQSLESTFVSIILALPSGDQAEVLTEWL 399 Query: 336 GTHHTQYPDLTEAFEVWCYRSKVAKRRLTLLGKMRSMSNS 217 + QYPDLTEAFEVWCYRSKV+KRRL+LL +M+NS Sbjct: 400 DNEYMQYPDLTEAFEVWCYRSKVSKRRLSLLEDEHAMTNS 439 >gb|ACU24099.1| unknown [Glycine max] Length = 336 Score = 138 bits (348), Expect = 4e-31 Identities = 64/100 (64%), Positives = 82/100 (82%) Frame = -3 Query: 516 LWLPFVRLSKPLISSWRVDVEGSPPFKVDNEIWQSLESSLVSMVLALPSGDQAEILTQWL 337 +WLPFVR++KPLI S ++ E + K+D E+WQSLES+ VS++LALPSGDQAE+LT+WL Sbjct: 236 VWLPFVRVTKPLIDSVTMNCENAMLLKLDGEMWQSLESTFVSIILALPSGDQAEVLTEWL 295 Query: 336 GTHHTQYPDLTEAFEVWCYRSKVAKRRLTLLGKMRSMSNS 217 + QYPDLTEAFEVWCYRSKV+KRRL+LL +M+NS Sbjct: 296 DNEYMQYPDLTEAFEVWCYRSKVSKRRLSLLEDEHAMTNS 335 >ref|XP_002264844.2| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Vitis vinifera] Length = 440 Score = 137 bits (346), Expect = 7e-31 Identities = 63/100 (63%), Positives = 82/100 (82%) Frame = -3 Query: 516 LWLPFVRLSKPLISSWRVDVEGSPPFKVDNEIWQSLESSLVSMVLALPSGDQAEILTQWL 337 +WLPFVR++K LI S + + + FK+D E+WQSLES+ VS+++ALPSGDQAEILT+WL Sbjct: 340 VWLPFVRVTKRLIDSIPTNGDDALTFKLDGELWQSLESAFVSIIVALPSGDQAEILTEWL 399 Query: 336 GTHHTQYPDLTEAFEVWCYRSKVAKRRLTLLGKMRSMSNS 217 G H +YPDLTEAFEVWCYRSKVAKRRL LLG + ++++ Sbjct: 400 GNEHIRYPDLTEAFEVWCYRSKVAKRRLALLGAIHGVTDA 439 >emb|CAN63084.1| hypothetical protein VITISV_015359 [Vitis vinifera] Length = 367 Score = 137 bits (346), Expect = 7e-31 Identities = 63/100 (63%), Positives = 82/100 (82%) Frame = -3 Query: 516 LWLPFVRLSKPLISSWRVDVEGSPPFKVDNEIWQSLESSLVSMVLALPSGDQAEILTQWL 337 +WLPFVR++K LI S + + + FK+D E+WQSLES+ VS+++ALPSGDQAEILT+WL Sbjct: 267 VWLPFVRVTKRLIDSIPTNGDDALTFKLDGELWQSLESAFVSIIVALPSGDQAEILTEWL 326 Query: 336 GTHHTQYPDLTEAFEVWCYRSKVAKRRLTLLGKMRSMSNS 217 G H +YPDLTEAFEVWCYRSKVAKRRL LLG + ++++ Sbjct: 327 GNEHIRYPDLTEAFEVWCYRSKVAKRRLALLGAIHGVTDA 366