BLASTX nr result
ID: Papaver23_contig00025769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00025769 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530680.1| PREDICTED: putative pentatricopeptide repeat... 73 2e-11 gb|AEP33771.1| organelle transcript processing 82, partial [Thla... 72 4e-11 ref|XP_003576937.1| PREDICTED: pentatricopeptide repeat-containi... 72 7e-11 gb|AEP33765.1| organelle transcript processing 82, partial [Lepi... 72 7e-11 ref|NP_172286.1| pentatricopeptide repeat-containing protein [Ar... 70 2e-10 >ref|XP_003530680.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Glycine max] Length = 616 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = +2 Query: 35 SQGIKKTPGCSSIEVEGESHEFVVADKSHPRYQEIYQLLDDIFFLLKLEGYIPETS 202 ++G+KK PGCS IEV+GE HEF+V DKSHPRY EI L++I L+L GY+ T+ Sbjct: 475 AKGVKKLPGCSVIEVDGEVHEFIVGDKSHPRYDEIEMKLEEISKCLRLSGYVANTN 530 >gb|AEP33771.1| organelle transcript processing 82, partial [Thlaspi arvense] Length = 673 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/56 (53%), Positives = 45/56 (80%) Frame = +2 Query: 38 QGIKKTPGCSSIEVEGESHEFVVADKSHPRYQEIYQLLDDIFFLLKLEGYIPETSQ 205 +G+KK PGCSSIE++ E HEF+V DK HPR +EIY +L+++ LL+ G++P+TS+ Sbjct: 533 KGMKKVPGCSSIEIDSEVHEFIVGDKLHPRNREIYGMLEEMEALLEEAGFVPDTSE 588 >ref|XP_003576937.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Brachypodium distachyon] Length = 661 Score = 71.6 bits (174), Expect = 7e-11 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +2 Query: 38 QGIKKTPGCSSIEVEGESHEFVVADKSHPRYQEIYQLLDDIFFLLKLEGYIPET 199 +G+KK PGCSSIEV+G+ HEF+VAD SH ++IY L +I+F LK EGY+P T Sbjct: 608 RGVKKNPGCSSIEVDGKFHEFLVADVSHVHSEDIYAALKNIYFHLKWEGYVPLT 661 >gb|AEP33765.1| organelle transcript processing 82, partial [Lepidium sativum] Length = 672 Score = 71.6 bits (174), Expect = 7e-11 Identities = 28/56 (50%), Positives = 45/56 (80%) Frame = +2 Query: 38 QGIKKTPGCSSIEVEGESHEFVVADKSHPRYQEIYQLLDDIFFLLKLEGYIPETSQ 205 +GIKK PGCSSIE++ HEF++ DK HPR +EIY++L+++ L++ G++P+TS+ Sbjct: 532 KGIKKAPGCSSIEIDSVVHEFIIGDKFHPRNREIYRMLEEMEMLMEETGFVPDTSE 587 >ref|NP_172286.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75174869|sp|Q9LN01.1|PPR21_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g08070 gi|8778839|gb|AAF79838.1|AC026875_18 T6D22.15 [Arabidopsis thaliana] gi|332190118|gb|AEE28239.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 741 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/56 (50%), Positives = 44/56 (78%) Frame = +2 Query: 38 QGIKKTPGCSSIEVEGESHEFVVADKSHPRYQEIYQLLDDIFFLLKLEGYIPETSQ 205 +G+KK PGCSSIE++ HEF++ DK HPR +EIY +L+++ LL+ G++P+TS+ Sbjct: 601 KGMKKVPGCSSIEIDSVVHEFIIGDKFHPRNREIYGMLEEMEVLLEKAGFVPDTSE 656