BLASTX nr result
ID: Papaver23_contig00025767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00025767 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637202.1| hypothetical protein MTR_077s0013 [Medicago ... 56 4e-06 >ref|XP_003637202.1| hypothetical protein MTR_077s0013 [Medicago truncatula] gi|355503137|gb|AES84340.1| hypothetical protein MTR_077s0013 [Medicago truncatula] Length = 586 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -3 Query: 435 LGFTKKVIRKKIDSLLKVYG-DEGWVFIEDGAYKLLID 325 LGF KKV+ + ++ LLKVYG +EGWVFIEDG Y+LLID Sbjct: 535 LGFDKKVVHQTVNKLLKVYGSNEGWVFIEDGDYRLLID 572