BLASTX nr result
ID: Papaver23_contig00025260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00025260 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX15514.1| ABA 8'-hydroxylase [Citrus sinensis] 64 5e-12 ref|XP_002282788.1| PREDICTED: abscisic acid 8'-hydroxylase 4 [V... 60 3e-11 emb|CBI19518.3| unnamed protein product [Vitis vinifera] 60 3e-11 ref|XP_002282233.1| PREDICTED: abscisic acid 8'-hydroxylase 4-li... 62 4e-11 emb|CBI32407.3| unnamed protein product [Vitis vinifera] 62 4e-11 >gb|AEX15514.1| ABA 8'-hydroxylase [Citrus sinensis] Length = 470 Score = 63.5 bits (153), Expect(2) = 5e-12 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 152 NMPVIF*VVLESLRMASIISFTFREAVEDVEYKGYL 45 NMPV + VVLESLRMASIISFTFREAV DVEYKGYL Sbjct: 330 NMPVTYKVVLESLRMASIISFTFREAVADVEYKGYL 365 Score = 32.0 bits (71), Expect(2) = 5e-12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 39 PQKFDPSRFEVAP 1 PQKFDPSRFEVAP Sbjct: 389 PQKFDPSRFEVAP 401 >ref|XP_002282788.1| PREDICTED: abscisic acid 8'-hydroxylase 4 [Vitis vinifera] Length = 470 Score = 60.1 bits (144), Expect(2) = 3e-11 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 152 NMPVIF*VVLESLRMASIISFTFREAVEDVEYKGYL 45 NMPV V+LESLRMASIISFTFREAV DVE+KGYL Sbjct: 330 NMPVTHKVILESLRMASIISFTFREAVADVEFKGYL 365 Score = 32.7 bits (73), Expect(2) = 3e-11 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 42 EPQKFDPSRFEVAP 1 +PQKFDPSRFEVAP Sbjct: 388 DPQKFDPSRFEVAP 401 >emb|CBI19518.3| unnamed protein product [Vitis vinifera] Length = 431 Score = 60.1 bits (144), Expect(2) = 3e-11 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 152 NMPVIF*VVLESLRMASIISFTFREAVEDVEYKGYL 45 NMPV V+LESLRMASIISFTFREAV DVE+KGYL Sbjct: 291 NMPVTHKVILESLRMASIISFTFREAVADVEFKGYL 326 Score = 32.7 bits (73), Expect(2) = 3e-11 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -3 Query: 42 EPQKFDPSRFEVAP 1 +PQKFDPSRFEVAP Sbjct: 349 DPQKFDPSRFEVAP 362 >ref|XP_002282233.1| PREDICTED: abscisic acid 8'-hydroxylase 4-like [Vitis vinifera] Length = 505 Score = 61.6 bits (148), Expect(2) = 4e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 152 NMPVIF*VVLESLRMASIISFTFREAVEDVEYKGYL 45 NMP+ + V+LESLRMASIISFTFREAV DVEYKGYL Sbjct: 361 NMPLTYRVILESLRMASIISFTFREAVVDVEYKGYL 396 Score = 30.8 bits (68), Expect(2) = 4e-11 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 EPQKFDPSRFEVAP 1 +PQ FDPSRFEVAP Sbjct: 419 DPQNFDPSRFEVAP 432 >emb|CBI32407.3| unnamed protein product [Vitis vinifera] Length = 479 Score = 61.6 bits (148), Expect(2) = 4e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 152 NMPVIF*VVLESLRMASIISFTFREAVEDVEYKGYL 45 NMP+ + V+LESLRMASIISFTFREAV DVEYKGYL Sbjct: 335 NMPLTYRVILESLRMASIISFTFREAVVDVEYKGYL 370 Score = 30.8 bits (68), Expect(2) = 4e-11 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 42 EPQKFDPSRFEVAP 1 +PQ FDPSRFEVAP Sbjct: 393 DPQNFDPSRFEVAP 406