BLASTX nr result
ID: Papaver23_contig00025118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00025118 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD32598.1| FAD linked oxidase, N-terminal [Medicago truncatula] 65 4e-09 dbj|BAD93999.1| berberine bridge enzyme-like protein [Arabidopsi... 65 6e-09 ref|NP_199251.1| FAD-binding and BBE domain-containing protein [... 65 6e-09 ref|XP_003608240.1| Reticuline oxidase-like protein [Medicago tr... 63 3e-08 emb|CBI31062.3| unnamed protein product [Vitis vinifera] 63 3e-08 >gb|ABD32598.1| FAD linked oxidase, N-terminal [Medicago truncatula] Length = 397 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 453 KYFKGNFDRLVAVKTKVDPDNFFRHEQSIPSIVYVLTI 340 KYFK NF+RLV+VKTKVDPDNFFRHEQSIPS +Y + I Sbjct: 360 KYFKENFERLVSVKTKVDPDNFFRHEQSIPSRLYEIHI 397 >dbj|BAD93999.1| berberine bridge enzyme-like protein [Arabidopsis thaliana] Length = 121 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 453 KYFKGNFDRLVAVKTKVDPDNFFRHEQSIPSIVY 352 KYFKGNFDRLV +KTKVDP+NFFRHEQSIP + Y Sbjct: 88 KYFKGNFDRLVKIKTKVDPENFFRHEQSIPPMPY 121 >ref|NP_199251.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana] gi|10176893|dbj|BAB10123.1| berberine bridge enzyme-like protein [Arabidopsis thaliana] gi|20260456|gb|AAM13126.1| berberine bridge enzyme-like protein [Arabidopsis thaliana] gi|110741126|dbj|BAE98656.1| berberine bridge enzyme-like protein [Arabidopsis thaliana] gi|332007720|gb|AED95103.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana] Length = 541 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 453 KYFKGNFDRLVAVKTKVDPDNFFRHEQSIPSIVY 352 KYFKGNFDRLV +KTKVDP+NFFRHEQSIP + Y Sbjct: 508 KYFKGNFDRLVKIKTKVDPENFFRHEQSIPPMPY 541 >ref|XP_003608240.1| Reticuline oxidase-like protein [Medicago truncatula] gi|355509295|gb|AES90437.1| Reticuline oxidase-like protein [Medicago truncatula] Length = 574 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 453 KYFKGNFDRLVAVKTKVDPDNFFRHEQSIPS 361 KYFK NF+RLV+VKTKVDPDNFFRHEQSIPS Sbjct: 511 KYFKENFERLVSVKTKVDPDNFFRHEQSIPS 541 >emb|CBI31062.3| unnamed protein product [Vitis vinifera] Length = 823 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 453 KYFKGNFDRLVAVKTKVDPDNFFRHEQSIP 364 KYFKGNF+RLV VKTKVDPDNFFRHEQSIP Sbjct: 350 KYFKGNFNRLVHVKTKVDPDNFFRHEQSIP 379