BLASTX nr result
ID: Papaver23_contig00024090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00024090 (1291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600473.1| hypothetical protein MTR_3g061570 [Medicago ... 58 6e-06 >ref|XP_003600473.1| hypothetical protein MTR_3g061570 [Medicago truncatula] gi|355489521|gb|AES70724.1| hypothetical protein MTR_3g061570 [Medicago truncatula] gi|388491896|gb|AFK34014.1| unknown [Medicago truncatula] Length = 142 Score = 57.8 bits (138), Expect = 6e-06 Identities = 31/78 (39%), Positives = 50/78 (64%), Gaps = 1/78 (1%) Frame = +3 Query: 609 NKKKRNEIEDHHQIW-SRESSYCTTPTAKQHKIPEAMTCPPAPKKQRHYYVLSSSAKAKK 785 +K+++ EI + + S +S C+TP ++++IPE TCPPAPKKQR V+S+ + + Sbjct: 68 SKEEKTEISEVIDVSNSNNNSACSTPKGQKYRIPEISTCPPAPKKQR---VVSNCSLRRS 124 Query: 786 RSDYFIPPPNLEAIFLTT 839 +F+ PP+LE FL T Sbjct: 125 PLSFFV-PPDLEHFFLVT 141