BLASTX nr result
ID: Papaver23_contig00023870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00023870 (579 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY80695.1| farnesyl pyrophosphate synthase [Cyclocarya paliu... 126 3e-27 gb|AEY80378.1| farnesyl diphosphate synthase [Santalum album] 122 4e-26 gb|ADO87007.1| E,E-farnesyl diphosphate synthase [Santalum album] 122 4e-26 gb|AAX76910.1| farnesyl diphosphate synthase [Vitis vinifera] 121 1e-25 ref|XP_002272641.1| PREDICTED: farnesyl pyrophosphate synthase 1... 121 1e-25 >gb|ACY80695.1| farnesyl pyrophosphate synthase [Cyclocarya paliurus] Length = 342 Score = 126 bits (316), Expect = 3e-27 Identities = 64/75 (85%), Positives = 65/75 (86%) Frame = +1 Query: 4 NDEQKKILYENYGKADSACVEKVKRLYKDLDLEGVFAEYERNSYEKLVSSIEAHPSKAVQ 183 N+EQ KILYENYGKAD ACV KVK LYK LDLE VFAEYE SYE LV SIEAHPSKAVQ Sbjct: 268 NEEQLKILYENYGKADEACVAKVKELYKVLDLESVFAEYESKSYENLVKSIEAHPSKAVQ 327 Query: 184 AVLKSFLAKIYKRQK 228 AVLKSFLAKIYKRQK Sbjct: 328 AVLKSFLAKIYKRQK 342 >gb|AEY80378.1| farnesyl diphosphate synthase [Santalum album] Length = 342 Score = 122 bits (306), Expect = 4e-26 Identities = 60/75 (80%), Positives = 65/75 (86%) Frame = +1 Query: 4 NDEQKKILYENYGKADSACVEKVKRLYKDLDLEGVFAEYERNSYEKLVSSIEAHPSKAVQ 183 N+EQKK+LYENYGKAD A V KVK LYK+LDLEG F EYE SYEK++SSIE PSKAVQ Sbjct: 268 NEEQKKLLYENYGKADEASVAKVKALYKELDLEGAFVEYENASYEKIISSIEVQPSKAVQ 327 Query: 184 AVLKSFLAKIYKRQK 228 AVLKSFLAKIYKRQK Sbjct: 328 AVLKSFLAKIYKRQK 342 >gb|ADO87007.1| E,E-farnesyl diphosphate synthase [Santalum album] Length = 342 Score = 122 bits (306), Expect = 4e-26 Identities = 60/75 (80%), Positives = 65/75 (86%) Frame = +1 Query: 4 NDEQKKILYENYGKADSACVEKVKRLYKDLDLEGVFAEYERNSYEKLVSSIEAHPSKAVQ 183 N+EQKK+LYENYGKAD A V KVK LYK+LDLEG F EYE SYEK++SSIE PSKAVQ Sbjct: 268 NEEQKKLLYENYGKADEASVAKVKALYKELDLEGAFVEYENASYEKIISSIEVQPSKAVQ 327 Query: 184 AVLKSFLAKIYKRQK 228 AVLKSFLAKIYKRQK Sbjct: 328 AVLKSFLAKIYKRQK 342 >gb|AAX76910.1| farnesyl diphosphate synthase [Vitis vinifera] Length = 341 Score = 121 bits (303), Expect = 1e-25 Identities = 62/75 (82%), Positives = 64/75 (85%) Frame = +1 Query: 4 NDEQKKILYENYGKADSACVEKVKRLYKDLDLEGVFAEYERNSYEKLVSSIEAHPSKAVQ 183 N+EQKK LY NYGKAD A V KVK LYKDLDL+GVF EYE SYE LVSSIEAHPSKAVQ Sbjct: 267 NEEQKKTLYGNYGKADPANVAKVKALYKDLDLQGVFLEYESKSYETLVSSIEAHPSKAVQ 326 Query: 184 AVLKSFLAKIYKRQK 228 AVLKSFL KIYKRQK Sbjct: 327 AVLKSFLGKIYKRQK 341 >ref|XP_002272641.1| PREDICTED: farnesyl pyrophosphate synthase 1 [Vitis vinifera] gi|296089967|emb|CBI39786.3| unnamed protein product [Vitis vinifera] Length = 341 Score = 121 bits (303), Expect = 1e-25 Identities = 62/75 (82%), Positives = 64/75 (85%) Frame = +1 Query: 4 NDEQKKILYENYGKADSACVEKVKRLYKDLDLEGVFAEYERNSYEKLVSSIEAHPSKAVQ 183 N+EQKK LY NYGKAD A V KVK LYKDLDL+GVF EYE SYE LVSSIEAHPSKAVQ Sbjct: 267 NEEQKKTLYGNYGKADPANVAKVKALYKDLDLQGVFLEYESKSYETLVSSIEAHPSKAVQ 326 Query: 184 AVLKSFLAKIYKRQK 228 AVLKSFL KIYKRQK Sbjct: 327 AVLKSFLGKIYKRQK 341