BLASTX nr result
ID: Papaver23_contig00022853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00022853 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD38147.1|AF139500_1 unknown [Prunus armeniaca] 74 9e-12 ref|XP_003521041.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 74 2e-11 ref|XP_002529301.1| Desacetoxyvindoline 4-hydroxylase, putative ... 72 6e-11 ref|XP_004171997.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 71 8e-11 ref|XP_004134073.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 71 8e-11 >gb|AAD38147.1|AF139500_1 unknown [Prunus armeniaca] Length = 370 Score = 74.3 bits (181), Expect = 9e-12 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 281 TILLQDHIAGLQFLHQNHWVTVKPIPGALTVNIGDLIQLISND 409 T+LLQDHI GLQ LHQN W+ V P+PGAL VNIGDL+QLISND Sbjct: 250 TVLLQDHIGGLQVLHQNTWIDVLPVPGALVVNIGDLLQLISND 292 >ref|XP_003521041.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like [Glycine max] Length = 378 Score = 73.6 bits (179), Expect = 2e-11 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 281 TILLQDHIAGLQFLHQNHWVTVKPIPGALTVNIGDLIQLISND 409 T+LLQDHI GLQ LH+N WV V P+PGAL +NIGDL+QLI+ND Sbjct: 255 TVLLQDHIGGLQVLHENRWVDVSPVPGALVINIGDLLQLITND 297 >ref|XP_002529301.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] gi|223531225|gb|EEF33070.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] Length = 359 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +2 Query: 281 TILLQDHIAGLQFLHQNHWVTVKPIPGALTVNIGDLIQLISND 409 T+LLQDHI GLQ HQN W+ V P PGAL VNIGDL+QLISND Sbjct: 239 TVLLQDHIGGLQVQHQNQWIDVPPTPGALVVNIGDLLQLISND 281 >ref|XP_004171997.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like, partial [Cucumis sativus] Length = 328 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +2 Query: 281 TILLQDHIAGLQFLHQNHWVTVKPIPGALTVNIGDLIQLISND 409 T+LLQDHI GLQ LH N WV + PIPGAL VN+G+L+QLISND Sbjct: 208 TVLLQDHIGGLQVLHDNKWVEIPPIPGALVVNVGNLLQLISND 250 >ref|XP_004134073.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like [Cucumis sativus] Length = 412 Score = 71.2 bits (173), Expect = 8e-11 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +2 Query: 281 TILLQDHIAGLQFLHQNHWVTVKPIPGALTVNIGDLIQLISND 409 T+LLQDHI GLQ LH N WV + PIPGAL VN+G+L+QLISND Sbjct: 292 TVLLQDHIGGLQVLHDNKWVEIPPIPGALVVNVGNLLQLISND 334