BLASTX nr result
ID: Papaver23_contig00021656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00021656 (830 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265052.1| PREDICTED: uncharacterized protein LOC100264... 70 6e-10 ref|XP_004140885.1| PREDICTED: uncharacterized protein LOC101204... 68 3e-09 ref|XP_002327968.1| predicted protein [Populus trichocarpa] gi|2... 62 1e-07 ref|NP_181859.1| Ribosomal L18p/L5e family protein [Arabidopsis ... 59 1e-06 ref|XP_002309809.1| predicted protein [Populus trichocarpa] gi|2... 59 1e-06 >ref|XP_002265052.1| PREDICTED: uncharacterized protein LOC100264652 [Vitis vinifera] Length = 123 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/47 (63%), Positives = 40/47 (85%) Frame = -3 Query: 825 ELGICDVRIDLHEELSRPIHHKKMVVSLFDSVKLTGVCVDGAEKLES 685 ++G+ DV ID+HEELSRPIHH++MV+ LF+SV+ G+ V GAEKLES Sbjct: 77 DIGVSDVEIDIHEELSRPIHHRRMVMPLFESVRRVGISVSGAEKLES 123 >ref|XP_004140885.1| PREDICTED: uncharacterized protein LOC101204363 [Cucumis sativus] gi|449499455|ref|XP_004160822.1| PREDICTED: uncharacterized LOC101204363 [Cucumis sativus] Length = 126 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = -3 Query: 825 ELGICDVRIDLHEELSRPIHHKKMVVSLFDSVKLTGVCVDGAEKL 691 E+G+ DVRIDL EELSRPI+++KMV+ LFDSV+ +GV VDGAEKL Sbjct: 77 EIGVSDVRIDLAEELSRPIYYRKMVLPLFDSVQRSGVAVDGAEKL 121 >ref|XP_002327968.1| predicted protein [Populus trichocarpa] gi|222837377|gb|EEE75756.1| predicted protein [Populus trichocarpa] Length = 127 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -3 Query: 822 LGICDVRIDLHEELSRPIHHKKMVVSLFDSVKLTGVCVDGAEKL 691 +G+ ++ IDL+EELSRPIH++K V+ LFDSVK G+ VDGAEKL Sbjct: 78 IGVSNIYIDLNEELSRPIHYRKRVLPLFDSVKRVGIVVDGAEKL 121 >ref|NP_181859.1| Ribosomal L18p/L5e family protein [Arabidopsis thaliana] gi|2289004|gb|AAB64333.1| hypothetical protein [Arabidopsis thaliana] gi|18491291|gb|AAL69470.1| F14B2.25/F14B2.25 [Arabidopsis thaliana] gi|20197150|gb|AAM14940.1| hypothetical protein [Arabidopsis thaliana] gi|28207054|gb|AAO37167.1| hypothetical protein [Arabidopsis thaliana] gi|61742679|gb|AAX55160.1| hypothetical protein At2g43310 [Arabidopsis thaliana] gi|330255155|gb|AEC10249.1| Ribosomal L18p/L5e family protein [Arabidopsis thaliana] Length = 133 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 825 ELGICDVRIDLHEELSRPIHHKKMVVSLFDSVKLTGVCVDGAEKL 691 ELG+ V ID EE+SRPIHH+K V+ LFDSV+ TG+ VDG E+L Sbjct: 78 ELGVDVVSIDADEEISRPIHHRKRVLPLFDSVRRTGIRVDGTEQL 122 >ref|XP_002309809.1| predicted protein [Populus trichocarpa] gi|222852712|gb|EEE90259.1| predicted protein [Populus trichocarpa] Length = 127 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -3 Query: 825 ELGICDVRIDLHEELSRPIHHKKMVVSLFDSVKLTGVCVDGAEKL 691 E+G+ ++ IDL+EELSRPIH++K V+ LF SVK G+ VDGAEKL Sbjct: 77 EIGVKNIYIDLNEELSRPIHYRKRVLPLFVSVKRVGIEVDGAEKL 121