BLASTX nr result
ID: Papaver23_contig00021575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00021575 (549 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP93564.1| GCS [Cestrum nocturnum] 101 9e-20 sp|Q1W2L8.2|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase,... 100 1e-19 dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia elegans] 100 1e-19 gb|AFF18844.2| gamma-glutamylcysteine synthetase [Dimocarpus lon... 100 2e-19 gb|AFF18843.1| gamma-glutamylcysteine synthetase, partial [Dimoc... 100 2e-19 >gb|AFP93564.1| GCS [Cestrum nocturnum] Length = 518 Score = 101 bits (251), Expect = 9e-20 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 526 DGLERRGYKETGFLNALTEVVDTGVTPAEKLLELYHGKWGQSVDPIFEELLY 371 +GLERRGYKETGFLN +TEVV TGVTPAEKLL+LYHGKWGQSVDP+FEELLY Sbjct: 467 EGLERRGYKETGFLNEVTEVVRTGVTPAEKLLDLYHGKWGQSVDPVFEELLY 518 >sp|Q1W2L8.2|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine synthetase; Flags: Precursor gi|111380512|gb|ABD98695.2| chloroplast gamma-glutamylcysteine synthetase [Nicotiana tabacum] Length = 522 Score = 100 bits (250), Expect = 1e-19 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 526 DGLERRGYKETGFLNALTEVVDTGVTPAEKLLELYHGKWGQSVDPIFEELLY 371 +GLERRGYKETGFLN +TEVV TGVTPAEKLLELYHGKWG+SVDP+FEELLY Sbjct: 471 EGLERRGYKETGFLNEVTEVVRTGVTPAEKLLELYHGKWGRSVDPVFEELLY 522 >dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia elegans] Length = 523 Score = 100 bits (250), Expect = 1e-19 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 526 DGLERRGYKETGFLNALTEVVDTGVTPAEKLLELYHGKWGQSVDPIFEELLY 371 DGLERRGYKETGFLN + EVV TG+TPAEKLLELYHGKWGQSVDP+FEELLY Sbjct: 472 DGLERRGYKETGFLNEVAEVVRTGLTPAEKLLELYHGKWGQSVDPVFEELLY 523 >gb|AFF18844.2| gamma-glutamylcysteine synthetase [Dimocarpus longan] Length = 511 Score = 100 bits (248), Expect = 2e-19 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 526 DGLERRGYKETGFLNALTEVVDTGVTPAEKLLELYHGKWGQSVDPIFEELLY 371 DGLERRG+KE+GFLNA+ EVV TGVTPAEKLLE+YHGKWGQSVDP+FEELLY Sbjct: 460 DGLERRGFKESGFLNAVAEVVRTGVTPAEKLLEMYHGKWGQSVDPVFEELLY 511 >gb|AFF18843.1| gamma-glutamylcysteine synthetase, partial [Dimocarpus longan] Length = 78 Score = 100 bits (248), Expect = 2e-19 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 526 DGLERRGYKETGFLNALTEVVDTGVTPAEKLLELYHGKWGQSVDPIFEELLY 371 DGLERRG+KE+GFLNA+ EVV TGVTPAEKLLE+YHGKWGQSVDP+FEELLY Sbjct: 27 DGLERRGFKESGFLNAVAEVVRTGVTPAEKLLEMYHGKWGQSVDPVFEELLY 78