BLASTX nr result
ID: Papaver23_contig00021501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00021501 (894 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624215.1| Transmembrane protein [Medicago truncatula] ... 49 7e-07 >ref|XP_003624215.1| Transmembrane protein [Medicago truncatula] gi|355499230|gb|AES80433.1| Transmembrane protein [Medicago truncatula] Length = 742 Score = 48.9 bits (115), Expect(2) = 7e-07 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 3/68 (4%) Frame = +3 Query: 456 IDETMDTSAMLGDIDGVLG---DMFQEFI*LSGM*YAKEPSTPVAKVSFGHFPLSFSAAT 626 ID TM A L V G D + + L + + PV K+SFGHFPLSFSA + Sbjct: 188 IDTTMSAGAGLRGPTNVFGHPTDQLLKDLDLELSHWDSQSEKPVTKISFGHFPLSFSAPS 247 Query: 627 YSGKTLKE 650 SG+TLKE Sbjct: 248 SSGRTLKE 255 Score = 30.8 bits (68), Expect(2) = 7e-07 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 679 SLEKHFQPNVHQNNYESSTDMGVG 750 SL+ FQ NVHQN++ES+ + +G Sbjct: 290 SLQNFFQFNVHQNSFESTVNCSIG 313