BLASTX nr result
ID: Papaver23_contig00021476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00021476 (523 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271768.1| PREDICTED: uncharacterized protein LOC100257... 70 2e-10 emb|CAN63103.1| hypothetical protein VITISV_029578 [Vitis vinifera] 70 2e-10 ref|XP_002316259.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|NP_181318.1| cysteine/histidine-rich C1 domain-containing pr... 67 2e-09 ref|XP_002273256.2| PREDICTED: delta-1-pyrroline-5-carboxylate s... 65 8e-09 >ref|XP_002271768.1| PREDICTED: uncharacterized protein LOC100257910 [Vitis vinifera] Length = 263 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/72 (38%), Positives = 35/72 (48%) Frame = +2 Query: 2 FYSCPFCPRKVEGFFLHPTCSTYPSRVDHPIDKHHHLTWQSGPLTWCTICTKLCPIWHYR 181 FY C C F +HP C+ P V H + H L Q WC +C +C W YR Sbjct: 101 FYRCKLCD-----FDVHPLCTQLPQYVRHALHPDHQLMLQPSVPGWCAVCKSVCSSWRYR 155 Query: 182 CEPCSVDVHFEC 217 C+ CS D+H EC Sbjct: 156 CKTCSFDIHLEC 167 >emb|CAN63103.1| hypothetical protein VITISV_029578 [Vitis vinifera] Length = 602 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/72 (38%), Positives = 35/72 (48%) Frame = +2 Query: 2 FYSCPFCPRKVEGFFLHPTCSTYPSRVDHPIDKHHHLTWQSGPLTWCTICTKLCPIWHYR 181 FY C C F +HP C+ P V H + H L Q WC +C +C W YR Sbjct: 440 FYRCKLCD-----FDVHPLCTQLPQYVRHALHPDHQLMLQPSVPGWCAVCKSVCSSWRYR 494 Query: 182 CEPCSVDVHFEC 217 C+ CS D+H EC Sbjct: 495 CKTCSFDIHLEC 506 >ref|XP_002316259.1| predicted protein [Populus trichocarpa] gi|222865299|gb|EEF02430.1| predicted protein [Populus trichocarpa] Length = 287 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/73 (38%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +2 Query: 2 FYSCPFCPRKVEGFFLHPTCSTYPSRVDHPIDKHHHLTWQSGPLT-WCTICTKLCPIWHY 178 FY+C FC F HP C+ P+++ H +H LT + ++ WC +C C W Y Sbjct: 101 FYTCSFCD-----FNAHPVCTQIPTKLQHGHLPNHSLTLRQPRMSSWCVVCWDACTSWRY 155 Query: 179 RCEPCSVDVHFEC 217 RC+ C VDVH +C Sbjct: 156 RCDICQVDVHLDC 168 >ref|NP_181318.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|40823046|gb|AAR92255.1| At2g37820 [Arabidopsis thaliana] gi|45752694|gb|AAS76245.1| At2g37820 [Arabidopsis thaliana] gi|66865894|gb|AAY57581.1| PHD domain protein [Arabidopsis thaliana] gi|330254360|gb|AEC09454.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 290 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/79 (35%), Positives = 37/79 (46%), Gaps = 9/79 (11%) Frame = +2 Query: 8 SCPFCPRKVEGFF---------LHPTCSTYPSRVDHPIDKHHHLTWQSGPLTWCTICTKL 160 +C C VEG F +HP C+ P V H + HHL ++ + C +C Sbjct: 89 ACDICDESVEGLFYRCKICEFDVHPLCTQLPQHVRHVLHPAHHLEFRPSGASTCMVCHGP 148 Query: 161 CPIWHYRCEPCSVDVHFEC 217 C W YRCE C D+H EC Sbjct: 149 CQSWRYRCELCRFDIHMEC 167 >ref|XP_002273256.2| PREDICTED: delta-1-pyrroline-5-carboxylate synthase [Vitis vinifera] Length = 1100 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/73 (38%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = +2 Query: 2 FYSCPFCPRKVEGFFLHPTCSTYPSRVDHPIDKHHHLTWQ-SGPLTWCTICTKLCPIWHY 178 FY C C F +HP C+ P V H +D H L Q S WC +C C W Y Sbjct: 91 FYQCTLCD-----FNIHPLCTKLPEYVPHALDPVHQLKLQTSSSPGWCRVCKSECTSWRY 145 Query: 179 RCEPCSVDVHFEC 217 C C+ D+H EC Sbjct: 146 GCRTCNFDIHLEC 158