BLASTX nr result
ID: Papaver23_contig00021454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00021454 (496 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279679.1| PREDICTED: probable calcium-binding protein ... 77 2e-12 ref|XP_002511733.1| calmodulin, putative [Ricinus communis] gi|2... 69 5e-10 ref|XP_003623726.1| Calcium-binding protein CML24 [Medicago trun... 68 9e-10 ref|XP_002320065.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 ref|XP_003521633.1| PREDICTED: probable calcium-binding protein ... 66 3e-09 >ref|XP_002279679.1| PREDICTED: probable calcium-binding protein CML10 isoform 2 [Vitis vinifera] gi|225453931|ref|XP_002279660.1| PREDICTED: probable calcium-binding protein CML10 isoform 1 [Vitis vinifera] Length = 204 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -1 Query: 496 ISPKELKQVLRSLGYYKCTLSECSAMIKGVDKDGDGLVNFEEFRSMMNGC 347 IS +EL++VL SLG KC+L EC MIKGVDKDGDG V+FEEFRSMM GC Sbjct: 149 ISAEELQRVLISLGCVKCSLQECKRMIKGVDKDGDGFVDFEEFRSMMTGC 198 >ref|XP_002511733.1| calmodulin, putative [Ricinus communis] gi|223548913|gb|EEF50402.1| calmodulin, putative [Ricinus communis] Length = 187 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -1 Query: 496 ISPKELKQVLRSLGYYKCTLSECSAMIKGVDKDGDGLVNFEEFRSMM 356 IS +ELK+VL +LG C+L +C MIKGVDKDGDG VNFEEFRSMM Sbjct: 130 ISAEELKKVLTNLGCDNCSLKKCRRMIKGVDKDGDGSVNFEEFRSMM 176 >ref|XP_003623726.1| Calcium-binding protein CML24 [Medicago truncatula] gi|355498741|gb|AES79944.1| Calcium-binding protein CML24 [Medicago truncatula] Length = 195 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = -1 Query: 496 ISPKELKQVLRSLGYYKCTLSECSAMIKGVDKDGDGLVNFEEFRSMM 356 IS KELK+VL +LG+ C++ EC MIKGVDK+GDG V++EEFRSMM Sbjct: 144 ISAKELKRVLINLGFDHCSIGECKRMIKGVDKNGDGFVDYEEFRSMM 190 >ref|XP_002320065.1| predicted protein [Populus trichocarpa] gi|222860838|gb|EEE98380.1| predicted protein [Populus trichocarpa] Length = 152 Score = 67.4 bits (163), Expect = 1e-09 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -1 Query: 496 ISPKELKQVLRSLGYYKCTLSECSAMIKGVDKDGDGLVNFEEFRSMM 356 IS +EL+ VL SLG KC+L +C MIKGVDKDGDG V+F EFRSMM Sbjct: 97 ISARELQTVLTSLGCKKCSLEDCRRMIKGVDKDGDGFVDFHEFRSMM 143 >ref|XP_003521633.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine max] Length = 228 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 496 ISPKELKQVLRSLGYYKCTLSECSAMIKGVDKDGDGLVNFEEFRSMM 356 IS KEL++VL +LG C+L EC MIKGVDK+GDG V+FEEFRSMM Sbjct: 176 ISAKELQRVLINLGCDNCSLRECKRMIKGVDKNGDGFVDFEEFRSMM 222