BLASTX nr result
ID: Papaver23_contig00021138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00021138 (736 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-contai... 246 5e-63 ref|XP_003616621.1| Pleckstrin homology domain-containing protei... 243 3e-62 gb|AAM61053.1| AtPH1-like protein [Arabidopsis thaliana] 241 9e-62 ref|NP_196190.1| pleckstrin homology domain-containing protein [... 241 1e-61 ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-contai... 241 1e-61 >ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] Length = 143 Score = 246 bits (627), Expect = 5e-63 Identities = 117/140 (83%), Positives = 125/140 (89%) Frame = -2 Query: 579 MASLWRYAMGSTQTQKEDYGGVEYWSNPERTGWLTKQGEYIKTWRRRWFILKQGKLFWFK 400 M SLWR A G T +DYGGVE+WSNPERTGWLTKQGEYIKTWRRRWF+LKQGKLFWFK Sbjct: 1 MWSLWRAATG-TADDSDDYGGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFK 59 Query: 399 ESMVNSSSIPRGVIPVGTCLTVKGAEDVLNKQFAFELSTNKETMYFIADSEKEKEEWINS 220 ES + +S PRGVIPV +CLTVKGAEDVLNKQFAFELST ETMYFIADSEKEKE+WINS Sbjct: 60 ESTITRASRPRGVIPVASCLTVKGAEDVLNKQFAFELSTRTETMYFIADSEKEKEDWINS 119 Query: 219 IGRSIVQHSRSVTDSEVVDY 160 IGRSIVQHSRSVTDSE+VDY Sbjct: 120 IGRSIVQHSRSVTDSEIVDY 139 >ref|XP_003616621.1| Pleckstrin homology domain-containing protein [Medicago truncatula] gi|355517956|gb|AES99579.1| Pleckstrin homology domain-containing protein [Medicago truncatula] gi|388509562|gb|AFK42847.1| unknown [Medicago truncatula] Length = 144 Score = 243 bits (620), Expect = 3e-62 Identities = 113/139 (81%), Positives = 125/139 (89%) Frame = -2 Query: 576 ASLWRYAMGSTQTQKEDYGGVEYWSNPERTGWLTKQGEYIKTWRRRWFILKQGKLFWFKE 397 ASLWRYA GST T DY GVE+WSNPERTGWLTKQGEYIKTWRRRWF+LKQGKLFWFKE Sbjct: 3 ASLWRYATGST-TNPVDYSGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKE 61 Query: 396 SMVNSSSIPRGVIPVGTCLTVKGAEDVLNKQFAFELSTNKETMYFIADSEKEKEEWINSI 217 S + +SIPRGVIPV TCLTVKGAED+L+K +AFELST +TMYFIADS+KEKE+WINSI Sbjct: 62 STITRASIPRGVIPVATCLTVKGAEDILHKPYAFELSTRADTMYFIADSDKEKEDWINSI 121 Query: 216 GRSIVQHSRSVTDSEVVDY 160 GRSIV HSRSVTDSE++DY Sbjct: 122 GRSIVLHSRSVTDSEIIDY 140 >gb|AAM61053.1| AtPH1-like protein [Arabidopsis thaliana] Length = 144 Score = 241 bits (616), Expect = 9e-62 Identities = 113/140 (80%), Positives = 122/140 (87%) Frame = -2 Query: 579 MASLWRYAMGSTQTQKEDYGGVEYWSNPERTGWLTKQGEYIKTWRRRWFILKQGKLFWFK 400 MASLWR +G EDYGGVE+WSNPERTGWLTKQGEYIKTWRRRWF+LKQGKLFWFK Sbjct: 1 MASLWRAVIGGQNNNSEDYGGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFK 60 Query: 399 ESMVNSSSIPRGVIPVGTCLTVKGAEDVLNKQFAFELSTNKETMYFIADSEKEKEEWINS 220 +S V S PRGV+PV +CLT KGAEDVLNKQ AFELST ETMYFIADSEKEKE+WINS Sbjct: 61 DSDVTRVSRPRGVVPVASCLTAKGAEDVLNKQNAFELSTRNETMYFIADSEKEKEDWINS 120 Query: 219 IGRSIVQHSRSVTDSEVVDY 160 IGRSIVQ+SRSVTDSE+VDY Sbjct: 121 IGRSIVQNSRSVTDSEIVDY 140 >ref|NP_196190.1| pleckstrin homology domain-containing protein [Arabidopsis thaliana] gi|9759096|dbj|BAB09665.1| AtPH1-like protein [Arabidopsis thaliana] gi|98960875|gb|ABF58921.1| At5g05710 [Arabidopsis thaliana] gi|110737775|dbj|BAF00826.1| AtPH1-like protein [Arabidopsis thaliana] gi|332003530|gb|AED90913.1| pleckstrin homology domain-containing protein [Arabidopsis thaliana] Length = 144 Score = 241 bits (614), Expect = 1e-61 Identities = 113/140 (80%), Positives = 122/140 (87%) Frame = -2 Query: 579 MASLWRYAMGSTQTQKEDYGGVEYWSNPERTGWLTKQGEYIKTWRRRWFILKQGKLFWFK 400 MASLWR +G EDYGGVE+WSNPERTGWLTKQGEYIKTWRRRWF+LKQGKLFWFK Sbjct: 1 MASLWRAVIGGQNNNSEDYGGVEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFK 60 Query: 399 ESMVNSSSIPRGVIPVGTCLTVKGAEDVLNKQFAFELSTNKETMYFIADSEKEKEEWINS 220 +S V S PRGV+PV +CLT KGAEDVLNKQ AFELST ETMYFIADSEKEKE+WINS Sbjct: 61 DSDVTRVSRPRGVVPVESCLTAKGAEDVLNKQNAFELSTRNETMYFIADSEKEKEDWINS 120 Query: 219 IGRSIVQHSRSVTDSEVVDY 160 IGRSIVQ+SRSVTDSE+VDY Sbjct: 121 IGRSIVQNSRSVTDSEIVDY 140 >ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] gi|147863745|emb|CAN83611.1| hypothetical protein VITISV_035612 [Vitis vinifera] Length = 143 Score = 241 bits (614), Expect = 1e-61 Identities = 115/140 (82%), Positives = 123/140 (87%) Frame = -2 Query: 579 MASLWRYAMGSTQTQKEDYGGVEYWSNPERTGWLTKQGEYIKTWRRRWFILKQGKLFWFK 400 M LWR A G + EDY GV++WS PER GWLTKQGEYIKTWRRRWF+LK+GKLFWFK Sbjct: 1 MEGLWRAAAG-LDPKPEDYEGVDFWSTPERAGWLTKQGEYIKTWRRRWFVLKRGKLFWFK 59 Query: 399 ESMVNSSSIPRGVIPVGTCLTVKGAEDVLNKQFAFELSTNKETMYFIADSEKEKEEWINS 220 +S V S PRGVIPVGTCLTVKGAEDVLNKQFAFELSTN++TMYFIADSEKEKEEWINS Sbjct: 60 DSYVTHDSKPRGVIPVGTCLTVKGAEDVLNKQFAFELSTNRDTMYFIADSEKEKEEWINS 119 Query: 219 IGRSIVQHSRSVTDSEVVDY 160 IGRSIVQHSRSVTDSEVVDY Sbjct: 120 IGRSIVQHSRSVTDSEVVDY 139