BLASTX nr result
ID: Papaver23_contig00021081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00021081 (620 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516199.1| fyve finger-containing phosphoinositide kina... 56 5e-06 >ref|XP_002516199.1| fyve finger-containing phosphoinositide kinase, fyv1, putative [Ricinus communis] gi|223544685|gb|EEF46201.1| fyve finger-containing phosphoinositide kinase, fyv1, putative [Ricinus communis] Length = 1821 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -1 Query: 119 MDSPTKSITDELLDVVKSWMPRKTKAANVSRDFWMPDHS 3 M +P I+D +D+VKSW+PR++++ NVSRDFWMPDHS Sbjct: 1 MGTPDNKISD-FVDIVKSWIPRRSESTNVSRDFWMPDHS 38