BLASTX nr result
ID: Papaver23_contig00020810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00020810 (472 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273897.1| PREDICTED: putative pterin-4-alpha-carbinola... 55 5e-06 emb|CAN63785.1| hypothetical protein VITISV_009254 [Vitis vinifera] 55 5e-06 ref|XP_004134631.1| PREDICTED: putative pterin-4-alpha-carbinola... 55 8e-06 ref|XP_002331865.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 ref|XP_002317303.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002273897.1| PREDICTED: putative pterin-4-alpha-carbinolamine dehydratase isoform 1 [Vitis vinifera] gi|297740640|emb|CBI30822.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 3 IDIWTHSVSGLTENDFILASKINTLELQHLLQR 101 I+IWTH+V GLTENDFILA+KIN L+LQ LL+R Sbjct: 140 IEIWTHAVGGLTENDFILAAKINGLDLQRLLRR 172 >emb|CAN63785.1| hypothetical protein VITISV_009254 [Vitis vinifera] Length = 156 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 3 IDIWTHSVSGLTENDFILASKINTLELQHLLQR 101 I+IWTH+V GLTENDFILA+KIN L+LQ LL+R Sbjct: 120 IEIWTHAVGGLTENDFILAAKINGLDLQRLLRR 152 >ref|XP_004134631.1| PREDICTED: putative pterin-4-alpha-carbinolamine dehydratase-like [Cucumis sativus] gi|449505947|ref|XP_004162611.1| PREDICTED: putative pterin-4-alpha-carbinolamine dehydratase-like [Cucumis sativus] Length = 195 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 3 IDIWTHSVSGLTENDFILASKINTLELQHLLQR 101 I+IWTH+V GLTENDFILASKI+ L++ HLL R Sbjct: 153 IEIWTHAVGGLTENDFILASKISKLDVHHLLSR 185 >ref|XP_002331865.1| predicted protein [Populus trichocarpa] gi|222875383|gb|EEF12514.1| predicted protein [Populus trichocarpa] Length = 124 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 3 IDIWTHSVSGLTENDFILASKINTLELQHLLQR 101 I+IWTH+V GLTENDFILA+KIN L L HLL++ Sbjct: 88 IEIWTHAVGGLTENDFILAAKINGLNLHHLLRK 120 >ref|XP_002317303.1| predicted protein [Populus trichocarpa] gi|222860368|gb|EEE97915.1| predicted protein [Populus trichocarpa] Length = 124 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 3 IDIWTHSVSGLTENDFILASKINTLELQHLLQR 101 I+IWTH+V GLTENDFILA+KIN L L HLL++ Sbjct: 88 IEIWTHAVGGLTENDFILAAKINGLNLHHLLRK 120